(data stored in ACNUC7421 zone)

EMBL: CP001825.PE375

CP001825.PE375       Location/Qualifiers
FT   CDS             complement(408936..409868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0377"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: pap:PSPA7_5505 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41299"
FT                   /db_xref="GOA:D1CEE3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEE3"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACZ41299.1"
FT                   /translation="MNVEDKLLDTGPGLVKKGAPSAIHILLALLAVYLIWGSTYLGIKF
FT                   ALSSFPPLLLGGIRFLIAGSVLYIWLRFQGHSKPTREQWLSCALVGALLLLIGNGGVGF
FT                   AEQNVASSLVALVIAATPLWAAIFLSLMGRKPGKLEWIGLTIGFLGVALLNLDGQLRSE
FT                   PISAAIVIASSICWSFGSVISQRLSIPSGLMASACEMLTGGALMLLIGLILGEKISLPI
FT                   TFEASVAIIYLTMIGSLVGFTAYSFLLENVRPSLATSYAYVNPIVAVILGAFIGNEHIS
FT                   PMIIVSMPLIILGIAIVVMTKSPSMEKED"
     MNVEDKLLDT GPGLVKKGAP SAIHILLALL AVYLIWGSTY LGIKFALSSF PPLLLGGIRF        60
     LIAGSVLYIW LRFQGHSKPT REQWLSCALV GALLLLIGNG GVGFAEQNVA SSLVALVIAA       120
     TPLWAAIFLS LMGRKPGKLE WIGLTIGFLG VALLNLDGQL RSEPISAAIV IASSICWSFG       180
     SVISQRLSIP SGLMASACEM LTGGALMLLI GLILGEKISL PITFEASVAI IYLTMIGSLV       240
     GFTAYSFLLE NVRPSLATSY AYVNPIVAVI LGAFIGNEHI SPMIIVSMPL IILGIAIVVM       300
     TKSPSMEKED                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page