(data stored in ACNUC7421 zone)

EMBL: CP001825.PE380

CP001825.PE380       Location/Qualifiers
FT   CDS             412284..412574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0382"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: nis:NIS_0956 MerR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41304"
FT                   /db_xref="GOA:D1CEE8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEE8"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ACZ41304.1"
FT                   /translation="MEYRNDRSFPKYTISVVSEMTGVPVHTIRQYEQQGLIRPARTTGK
FT                   TRRYSDEDVEMIMQIADLARKGINYPGIREVLRIRKEHTSNHPDKPNKQSA"
     MEYRNDRSFP KYTISVVSEM TGVPVHTIRQ YEQQGLIRPA RTTGKTRRYS DEDVEMIMQI        60
     ADLARKGINY PGIREVLRIR KEHTSNHPDK PNKQSA                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page