(data stored in ACNUC7421 zone)

EMBL: CP001825.PE382

CP001825.PE382       Location/Qualifiers
FT   CDS             413159..413665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0384"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: bcr:BCAH187_A5499
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41306"
FT                   /db_xref="GOA:D1CEF0"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEF0"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ACZ41306.1"
FT                   /translation="MFDAALLVLRVVVGLLFIGHGAQKLFGWFGGGGLKGTAHFMESLG
FT                   LTPGRYWAVLAGLSEFVGGLLMLTGLLNPIGPLAILGAMIMATVKAHWGKPIWSSSGGA
FT                   ELPVVYGAIAVALLLTGYGRYSLDNLLNISLPSWVVLAGFLVIMLLLVLATVPGVSRSA
FT                   KYSTS"
     MFDAALLVLR VVVGLLFIGH GAQKLFGWFG GGGLKGTAHF MESLGLTPGR YWAVLAGLSE        60
     FVGGLLMLTG LLNPIGPLAI LGAMIMATVK AHWGKPIWSS SGGAELPVVY GAIAVALLLT       120
     GYGRYSLDNL LNISLPSWVV LAGFLVIMLL LVLATVPGVS RSAKYSTS                    168
//

If you have problems or comments...

PBIL Back to PBIL home page