(data stored in ACNUC7421 zone)

EMBL: CP001825.PE383

CP001825.PE383       Location/Qualifiers
FT   CDS             413866..414675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0385"
FT                   /product="serine/threonine phosphoprotein phosphatase"
FT                   /note="KEGG: xca:xccb100_3125 serine/threonine
FT                   phosphoprotein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41307"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEF1"
FT                   /inference="similar to AA sequence:KEGG:xccb100_3125"
FT                   /protein_id="ACZ41307.1"
FT                   /translation="MTCSWKYAFASVIGTYHLSRGLPCQDAIRVSLCRLEKEDVLLAVV
FT                   SDGAGSAARGDEGSEFACQFFVEKLHDFVLSGSEICTLDRELCVGWVKDYLSHLEERAN
FT                   SCEAQISDYASTLLAAVVGSRSAVFLQIGDGAIVASTEDDPDSYTAIFWPQKGEYESTT
FT                   FFLTDNNSHENLLILSLDDVSICDLAIFTDGLQRIALDFTENEAYNPFFRGMFNPLRGQ
FT                   FDGYLQELSEQLKNFLGSPRVNEYTEDDKTLLLASRVIGQQLSEVPD"
     MTCSWKYAFA SVIGTYHLSR GLPCQDAIRV SLCRLEKEDV LLAVVSDGAG SAARGDEGSE        60
     FACQFFVEKL HDFVLSGSEI CTLDRELCVG WVKDYLSHLE ERANSCEAQI SDYASTLLAA       120
     VVGSRSAVFL QIGDGAIVAS TEDDPDSYTA IFWPQKGEYE STTFFLTDNN SHENLLILSL       180
     DDVSICDLAI FTDGLQRIAL DFTENEAYNP FFRGMFNPLR GQFDGYLQEL SEQLKNFLGS       240
     PRVNEYTEDD KTLLLASRVI GQQLSEVPD                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page