(data stored in ACNUC7421 zone)

EMBL: CP001825.PE386

CP001825.PE386       Location/Qualifiers
FT   CDS             416400..416879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0388"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: mca:MCA2731 flavin reductase-like domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41310"
FT                   /db_xref="GOA:D1CEF4"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEF4"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ACZ41310.1"
FT                   /translation="MDQAVKKQVLRSFTYGLYLITVKDGEEANCFTANWVSQASFEPPM
FT                   VVFSMENDSRSIGMIQRSGAFAVHVIPEGYRDFAGRMGRSSKQNPNKISEVEWEPGEVT
FT                   GSPILKELAGWVECRLVGTLPAGDHTLMLGEVVNAGIGRDLRPLTLSEAGFKYSG"
     MDQAVKKQVL RSFTYGLYLI TVKDGEEANC FTANWVSQAS FEPPMVVFSM ENDSRSIGMI        60
     QRSGAFAVHV IPEGYRDFAG RMGRSSKQNP NKISEVEWEP GEVTGSPILK ELAGWVECRL       120
     VGTLPAGDHT LMLGEVVNAG IGRDLRPLTL SEAGFKYSG                              159
//

If you have problems or comments...

PBIL Back to PBIL home page