(data stored in ACNUC7421 zone)

EMBL: CP001825.PE391

CP001825.PE391       Location/Qualifiers
FT   CDS             complement(421302..422345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0393"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; short-chain dehydrogenase/reductase SDR;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: scl:sce7003
FT                   NDP-sugar oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41315"
FT                   /db_xref="GOA:D1CEF9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEF9"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACZ41315.1"
FT                   /translation="MSNEKVLITGGAGFLGINLVRHLLRKGFRVASLDIAEFDYPERNQ
FT                   VEVIKGDIRDKALLDQVMVGVDYVVHTAAALPLYSPKDIYTTDVIGTRNVLDSAYTHGV
FT                   KRVVHISSTAVYGIPDHHPIREEDRLEGVGPYGQAKIQAEMICLEYRAKGLIVPIIRPK
FT                   SFVGPERLGVFALLYDWAYTGHNFPVLGSGRNRYQLLDVEDLCDAIELCLTLPENKVND
FT                   TFNIGAKVFSTVREDYQAVLDYAGHGKKVIPIPAAPAIFILRLLEKLGISPLYKWVYET
FT                   APKDSYVSIEKAEKQLGFKPKYSNKEALIRNFQWYIDNIDKFQNKSGVSHRVPWKQGAL
FT                   SLAKLIF"
     MSNEKVLITG GAGFLGINLV RHLLRKGFRV ASLDIAEFDY PERNQVEVIK GDIRDKALLD        60
     QVMVGVDYVV HTAAALPLYS PKDIYTTDVI GTRNVLDSAY THGVKRVVHI SSTAVYGIPD       120
     HHPIREEDRL EGVGPYGQAK IQAEMICLEY RAKGLIVPII RPKSFVGPER LGVFALLYDW       180
     AYTGHNFPVL GSGRNRYQLL DVEDLCDAIE LCLTLPENKV NDTFNIGAKV FSTVREDYQA       240
     VLDYAGHGKK VIPIPAAPAI FILRLLEKLG ISPLYKWVYE TAPKDSYVSI EKAEKQLGFK       300
     PKYSNKEALI RNFQWYIDNI DKFQNKSGVS HRVPWKQGAL SLAKLIF                     347
//

If you have problems or comments...

PBIL Back to PBIL home page