(data stored in ACNUC7421 zone)

EMBL: CP001825.PE392

CP001825.PE392       Location/Qualifiers
FT   CDS             422446..423654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0394"
FT                   /product="Myo-inositol-1-phosphate synthase"
FT                   /note="PFAM: Myo-inositol-1-phosphate synthase; Myo-
FT                   inositol-1-phosphate synthase GAPDH domain protein; KEGG:
FT                   sme:SM_b20249 putative myo-inositol-1- phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41316"
FT                   /db_xref="GOA:D1CEG0"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEG0"
FT                   /inference="protein motif:PFAM:PF07994"
FT                   /protein_id="ACZ41316.1"
FT                   /translation="MHALTIRSSHAYTPLYVCKNRERGNEVADKKVRVAIIGVGNCASA
FT                   FVQGVHYYKDAPEDEWVPGLMHVNLGGYHIRDIEFSAAFDVASTKVGKDLSEAIWAAPN
FT                   NTLKFADVPYLGVPVYRGMTHDGLGKYLSNMIEKAPGPTSNIVQILKDTGTDVVVNYLP
FT                   VGSEMATKWYVEQVLEAGCAFVNCIPVFIAREEYWQRRFLEKGLPIIGDDIKSQVGATI
FT                   THRVLTRLFEERGVKLERTYQLNFGGNTDFYNMLERDRLESKKISKTNAVTSQLEHSKL
FT                   DEKNVHVGPSDYVPWLEDRKWCHIRMEGTIFGGAPISLELKLEVWDSPNSAGVVIDAVR
FT                   CAKLALDRGLAGTIAGPSAYFMKSPPVQYHDDVARRMTEDFIEGKDDTCLPFKTTIDTA
FT                   EKV"
     MHALTIRSSH AYTPLYVCKN RERGNEVADK KVRVAIIGVG NCASAFVQGV HYYKDAPEDE        60
     WVPGLMHVNL GGYHIRDIEF SAAFDVASTK VGKDLSEAIW AAPNNTLKFA DVPYLGVPVY       120
     RGMTHDGLGK YLSNMIEKAP GPTSNIVQIL KDTGTDVVVN YLPVGSEMAT KWYVEQVLEA       180
     GCAFVNCIPV FIAREEYWQR RFLEKGLPII GDDIKSQVGA TITHRVLTRL FEERGVKLER       240
     TYQLNFGGNT DFYNMLERDR LESKKISKTN AVTSQLEHSK LDEKNVHVGP SDYVPWLEDR       300
     KWCHIRMEGT IFGGAPISLE LKLEVWDSPN SAGVVIDAVR CAKLALDRGL AGTIAGPSAY       360
     FMKSPPVQYH DDVARRMTED FIEGKDDTCL PFKTTIDTAE KV                          402
//

If you have problems or comments...

PBIL Back to PBIL home page