(data stored in ACNUC7421 zone)

EMBL: CP001825.PE394

CP001825.PE394       Location/Qualifiers
FT   CDS             424364..425230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0396"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   rpb:RPB_4430 luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41318"
FT                   /db_xref="GOA:D1CEG2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019921"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEG2"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACZ41318.1"
FT                   /translation="MKVGVTFPQIEIGNDPHVIKDYAQAAEDLGYNHLLVFDHVLGADP
FT                   TNRPGWRGSYSIDDPFHEPFVLFGYLAAVTQKLELVTGVIILPQRQTALVAKQAAEVDV
FT                   LTGGRLRLGVGVGWNEVEYEALGMNFHNRGRRIEEQVEVLRLLWTQKVVTFHGKYHHIT
FT                   EAGINPLPVQRPIPLWMGGSADVLLRRAARMADGWFPQMPPNQTAEEALSRLRAYLQAE
FT                   GRDPNSFGLEARITIAGLSEDDWVAQFKGWEKLGATHISVNTMRAGLSSPQDHINAIRR
FT                   FKEVIGF"
     MKVGVTFPQI EIGNDPHVIK DYAQAAEDLG YNHLLVFDHV LGADPTNRPG WRGSYSIDDP        60
     FHEPFVLFGY LAAVTQKLEL VTGVIILPQR QTALVAKQAA EVDVLTGGRL RLGVGVGWNE       120
     VEYEALGMNF HNRGRRIEEQ VEVLRLLWTQ KVVTFHGKYH HITEAGINPL PVQRPIPLWM       180
     GGSADVLLRR AARMADGWFP QMPPNQTAEE ALSRLRAYLQ AEGRDPNSFG LEARITIAGL       240
     SEDDWVAQFK GWEKLGATHI SVNTMRAGLS SPQDHINAIR RFKEVIGF                    288
//

If you have problems or comments...

PBIL Back to PBIL home page