(data stored in ACNUC7421 zone)

EMBL: CP001825.PE396

CP001825.PE396       Location/Qualifiers
FT   CDS             427432..428370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0398"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: scl:sce5040
FT                   trehalose/maltose transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41320"
FT                   /db_xref="GOA:D1CEG4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEG4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41320.1"
FT                   /translation="MAQQIRLARARQEKSSQENSALARRQARVAWLFLIPTLLVVAIVA
FT                   AWPMIQVVWLSLTNAQLLSPTPPKFIGLDNYVRLIHDSIWWHTVWNTVLFTVITVTFEF
FT                   VLGMVIALVVNSQFKARGFMRAAMLVPWAIPTVVSAMMWKWMYNDIYGVINDLLVNKLH
FT                   ILDHNVAFLAVPSLAIPSVAAIDIWKTTPFVALLLLAGLQVIPNDIYEAATVDGATAWQ
FT                   RFFQITLPLLRPAIAVTLIFRTLDALRVFDVFYVMFGNDQSRMPMAVYVQNYLVQFQDV
FT                   GYSSAISMFIFMIIGIFVVAYVTTLGVEVEQ"
     MAQQIRLARA RQEKSSQENS ALARRQARVA WLFLIPTLLV VAIVAAWPMI QVVWLSLTNA        60
     QLLSPTPPKF IGLDNYVRLI HDSIWWHTVW NTVLFTVITV TFEFVLGMVI ALVVNSQFKA       120
     RGFMRAAMLV PWAIPTVVSA MMWKWMYNDI YGVINDLLVN KLHILDHNVA FLAVPSLAIP       180
     SVAAIDIWKT TPFVALLLLA GLQVIPNDIY EAATVDGATA WQRFFQITLP LLRPAIAVTL       240
     IFRTLDALRV FDVFYVMFGN DQSRMPMAVY VQNYLVQFQD VGYSSAISMF IFMIIGIFVV       300
     AYVTTLGVEV EQ                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page