(data stored in ACNUC7421 zone)

EMBL: CP001825.PE399

CP001825.PE399       Location/Qualifiers
FT   CDS             429941..431404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0401"
FT                   /product="protein of unknown function DUF512"
FT                   /note="PFAM: protein of unknown function DUF512; KEGG:
FT                   gbm:Gbem_0981 protein of unknown function DUF512"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41323"
FT                   /db_xref="GOA:D1CEG7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007549"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEG7"
FT                   /inference="protein motif:PFAM:PF04459"
FT                   /protein_id="ACZ41323.1"
FT                   /translation="MIHGGEVVRVQPNSIADDLGLQPGDVLLQINGRPLRDIIDYRFYG
FT                   AADYVELLVKRGQEYIIFEIEKDPDESLGVEFARPTFNPIRQCANACPFCFVDQNREGM
FT                   RDSLYIRDDDYRYSFLFGNFVTLTNLTPSDWRRLEEQRLSPLYVSVHTTDPDLRRRLLG
FT                   YPKAPDILEQLARLREIGIQVHTQLVLCPGLNDGPQLERTIDDLAALYPTVLSIAVVPV
FT                   GLTQFRGGSVRAGGRHNRIIASQASTPVRSYTPEEAKQVVKQVDRRRAQFRKELGTNLV
FT                   FASDEFYLMAGKSVPAAKHYEGFPQLENGIGMVRYMLEGFKESRRKLPERLKSTRKVTI
FT                   LCGTLPAKVLRQVADKMQDACSGLSVDVIPVENKFYGPSTNVSGLLVGEDLVPIIESIE
FT                   GTDLILIPRVALDNDGRRLLDGVTLQDLRDVAKYPLEPAVDMKETVDLILRMDAGEELG
FT                   KSVPPPRIGGFEFSPVPNSDTFGQYVTYS"
     MIHGGEVVRV QPNSIADDLG LQPGDVLLQI NGRPLRDIID YRFYGAADYV ELLVKRGQEY        60
     IIFEIEKDPD ESLGVEFARP TFNPIRQCAN ACPFCFVDQN REGMRDSLYI RDDDYRYSFL       120
     FGNFVTLTNL TPSDWRRLEE QRLSPLYVSV HTTDPDLRRR LLGYPKAPDI LEQLARLREI       180
     GIQVHTQLVL CPGLNDGPQL ERTIDDLAAL YPTVLSIAVV PVGLTQFRGG SVRAGGRHNR       240
     IIASQASTPV RSYTPEEAKQ VVKQVDRRRA QFRKELGTNL VFASDEFYLM AGKSVPAAKH       300
     YEGFPQLENG IGMVRYMLEG FKESRRKLPE RLKSTRKVTI LCGTLPAKVL RQVADKMQDA       360
     CSGLSVDVIP VENKFYGPST NVSGLLVGED LVPIIESIEG TDLILIPRVA LDNDGRRLLD       420
     GVTLQDLRDV AKYPLEPAVD MKETVDLILR MDAGEELGKS VPPPRIGGFE FSPVPNSDTF       480
     GQYVTYS                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page