(data stored in ACNUC7421 zone)

EMBL: CP001825.PE400

CP001825.PE400       Location/Qualifiers
FT   CDS             complement(431500..432582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0402"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   rpb:RPB_3120 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41324"
FT                   /db_xref="GOA:D1CEG8"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEG8"
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /protein_id="ACZ41324.1"
FT                   /translation="MFTKSSKVWVLLLLFLQLVVVGCGAGNSTPTIGSTSANITPTTSS
FT                   ESNQNSQNTSSNLKQVTLALGYIPTVQFAPYYVAQEKGFYKEEGLNVKFNHGIISDLIK
FT                   MVGTGKIPYGVASGDEVLVARSQGVPVVYLGAYFQKYPVVLITRSEDHITDIKQLKGKV
FT                   IGVPGQFGATYTGLLALLHSANMNEKDVKIRSIGFTQVQALERKQVDAVMGYANNEPIQ
FT                   LRHLGVKVNTIPVWEHLNLVSNGLITSQDKLSSDPQEAAAVVRATMKGLQYTIDHPEEA
FT                   FQISLKYVPEAAQDKEIQMEVLKSSIELWQSQATKEHGLGYTDPNMWKTTLDFLKSIGL
FT                   IKHDVDLSKVYTNQFVERSR"
     MFTKSSKVWV LLLLFLQLVV VGCGAGNSTP TIGSTSANIT PTTSSESNQN SQNTSSNLKQ        60
     VTLALGYIPT VQFAPYYVAQ EKGFYKEEGL NVKFNHGIIS DLIKMVGTGK IPYGVASGDE       120
     VLVARSQGVP VVYLGAYFQK YPVVLITRSE DHITDIKQLK GKVIGVPGQF GATYTGLLAL       180
     LHSANMNEKD VKIRSIGFTQ VQALERKQVD AVMGYANNEP IQLRHLGVKV NTIPVWEHLN       240
     LVSNGLITSQ DKLSSDPQEA AAVVRATMKG LQYTIDHPEE AFQISLKYVP EAAQDKEIQM       300
     EVLKSSIELW QSQATKEHGL GYTDPNMWKT TLDFLKSIGL IKHDVDLSKV YTNQFVERSR       360
//

If you have problems or comments...

PBIL Back to PBIL home page