(data stored in ACNUC7421 zone)

EMBL: CP001825.PE403

CP001825.PE403       Location/Qualifiers
FT   CDS             434373..435275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0405"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rle:pRL110512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41327"
FT                   /db_xref="GOA:D1CEH1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEH1"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACZ41327.1"
FT                   /translation="MELRELRECDLLDLLDLCSRTLPLDKFSINLLKHRIFQEPEHRPE
FT                   YQLSLWDGDKLVSVMLGGVRTSEEGPAPAIRLFATDPAYQRRGYATQLLKELINRIQAD
FT                   GMKTLRVGGSAPIYFWPGVDVRYTPAICFLIKHGFQIADVRCFNMEVDLLSRDWDTSAD
FT                   EDRLAREGFVFRRLSLDDREEFSKWLLDVWGSTWQCEALATYQNEPISTHIALRDGRIC
FT                   AFASYGGTAFENGFGPTGTEEQLRGKGIGRILFYRCMRDLRMLGHEKCEVIWVGPIPFY
FT                   AKVADAKINRVFWVLGKQI"
     MELRELRECD LLDLLDLCSR TLPLDKFSIN LLKHRIFQEP EHRPEYQLSL WDGDKLVSVM        60
     LGGVRTSEEG PAPAIRLFAT DPAYQRRGYA TQLLKELINR IQADGMKTLR VGGSAPIYFW       120
     PGVDVRYTPA ICFLIKHGFQ IADVRCFNME VDLLSRDWDT SADEDRLARE GFVFRRLSLD       180
     DREEFSKWLL DVWGSTWQCE ALATYQNEPI STHIALRDGR ICAFASYGGT AFENGFGPTG       240
     TEEQLRGKGI GRILFYRCMR DLRMLGHEKC EVIWVGPIPF YAKVADAKIN RVFWVLGKQI       300
//

If you have problems or comments...

PBIL Back to PBIL home page