(data stored in ACNUC7421 zone)

EMBL: CP001825.PE404

CP001825.PE404       Location/Qualifiers
FT   CDS             435296..436318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0406"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Semialdehyde
FT                   dehydrogenase NAD - binding; Oxidoreductase domain; KEGG:
FT                   bha:BH1248 NADH-dependent dyhydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41328"
FT                   /db_xref="GOA:D1CEH2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEH2"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACZ41328.1"
FT                   /translation="MPVRVAILGCGLIAQREHIPAYVKSEDAQITVFASRDLSKAERLK
FT                   NEYGANAATDDWKEAILRDDVDVVDICLPNYLHAPAAIAAAEAGKHIIVEKPIARTIAE
FT                   ADAMIEAANKNGVKLMVAHSLRFAPPAEEAQRLVSEGFIGEVKAVRALLNHAGPIEYWG
FT                   ATDTWFFELTKSGGGALLDLGIHVADLVQWVVGAPASSVSAMVVNSGRFGDVEDMGMAT
FT                   IRFSNDVLGFIQASWNYRPKNEANLVVYGDKGTLYAWAYPGKPLVANLRSEDSPDGKLV
FT                   ELEVPQSSRRNNPFDYFVRWVLDKAEPFSTGEEARAALQIITGAYASAKSRCEVELPRF
FT                   "
     MPVRVAILGC GLIAQREHIP AYVKSEDAQI TVFASRDLSK AERLKNEYGA NAATDDWKEA        60
     ILRDDVDVVD ICLPNYLHAP AAIAAAEAGK HIIVEKPIAR TIAEADAMIE AANKNGVKLM       120
     VAHSLRFAPP AEEAQRLVSE GFIGEVKAVR ALLNHAGPIE YWGATDTWFF ELTKSGGGAL       180
     LDLGIHVADL VQWVVGAPAS SVSAMVVNSG RFGDVEDMGM ATIRFSNDVL GFIQASWNYR       240
     PKNEANLVVY GDKGTLYAWA YPGKPLVANL RSEDSPDGKL VELEVPQSSR RNNPFDYFVR       300
     WVLDKAEPFS TGEEARAALQ IITGAYASAK SRCEVELPRF                             340
//

If you have problems or comments...

PBIL Back to PBIL home page