(data stored in ACNUC7421 zone)

EMBL: CP001825.PE405

CP001825.PE405       Location/Qualifiers
FT   CDS             complement(436308..437066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0407"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related; KEGG: mpo:Mpop_4104
FT                   phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41329"
FT                   /db_xref="GOA:D1CEH3"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEH3"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ACZ41329.1"
FT                   /translation="MQDRVDRDFTREEQPLAVGDEHLSELEERIGAAPARISILLLGFV
FT                   GSLMLILLMAIIARDIFPEQSISLDRTIYLYLRNHASSFPGPLFVLGTYLGSFIVIGPL
FT                   TAAICALLFLKGYRRTPTFLVVSAVGGILVNQVFKDYVTRPRPSWPGIHQIGDYSFPSG
FT                   HAMNSVVFYIALASIIWVLFGKLYGTISFIIAIFLALFIGTSRIYFGYHYFTDVIGGYI
FT                   TGLLWVVIAATATQGGSHIIRQRRANKSKI"
     MQDRVDRDFT REEQPLAVGD EHLSELEERI GAAPARISIL LLGFVGSLML ILLMAIIARD        60
     IFPEQSISLD RTIYLYLRNH ASSFPGPLFV LGTYLGSFIV IGPLTAAICA LLFLKGYRRT       120
     PTFLVVSAVG GILVNQVFKD YVTRPRPSWP GIHQIGDYSF PSGHAMNSVV FYIALASIIW       180
     VLFGKLYGTI SFIIAIFLAL FIGTSRIYFG YHYFTDVIGG YITGLLWVVI AATATQGGSH       240
     IIRQRRANKS KI                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page