(data stored in ACNUC7421 zone)

EMBL: CP001825.PE408

CP001825.PE408       Location/Qualifiers
FT   CDS             439099..440250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0410"
FT                   /product="Malate/L-lactate dehydrogenase"
FT                   /note="PFAM: Malate/L-lactate dehydrogenase; KEGG:
FT                   sat:SYN_02526 malate/L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41332"
FT                   /db_xref="GOA:D1CEH6"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEH6"
FT                   /inference="protein motif:PFAM:PF02615"
FT                   /protein_id="ACZ41332.1"
FT                   /translation="MANVEESRDQDYISVDHMALKSWVTEVFCKLGVPREDADVTADVL
FT                   VAADLRGIESHGVARLGRYTSRLMKGLISPVANPVIVRETSSTALVDGNNGLGQPVAMW
FT                   AMQLAIDKAREVGSGTVAVRNSNHYGIAGYYAMMALEHDMIGMSLTNSSPLVVPTGGRK
FT                   AVIGTNPIAVAIPAGKERPWVLDMATSVVPRGKLEVYARKNKPMPLGWAVDETGQPTTD
FT                   AQRVLDALTARLGGGILPLGGTALFSGYKGYNLSVMVDLLCGVLPGSNWGPKVDEPVDG
FT                   KLVPSRVGHFFWALRVDAFRPIDEFKQEMDDYIRMLKESPKAEGEDRIWVAGEKEWELQ
FT                   EEYSREGVPLYYKVVETLRGIGQEVGLPFDAMVLGAGHSTGMA"
     MANVEESRDQ DYISVDHMAL KSWVTEVFCK LGVPREDADV TADVLVAADL RGIESHGVAR        60
     LGRYTSRLMK GLISPVANPV IVRETSSTAL VDGNNGLGQP VAMWAMQLAI DKAREVGSGT       120
     VAVRNSNHYG IAGYYAMMAL EHDMIGMSLT NSSPLVVPTG GRKAVIGTNP IAVAIPAGKE       180
     RPWVLDMATS VVPRGKLEVY ARKNKPMPLG WAVDETGQPT TDAQRVLDAL TARLGGGILP       240
     LGGTALFSGY KGYNLSVMVD LLCGVLPGSN WGPKVDEPVD GKLVPSRVGH FFWALRVDAF       300
     RPIDEFKQEM DDYIRMLKES PKAEGEDRIW VAGEKEWELQ EEYSREGVPL YYKVVETLRG       360
     IGQEVGLPFD AMVLGAGHST GMA                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page