(data stored in ACNUC7421 zone)

EMBL: CP001825.PE409

CP001825.PE409       Location/Qualifiers
FT   CDS             complement(440290..441780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0411"
FT                   /product="xylulokinase"
FT                   /note="TIGRFAM: xylulokinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: aba:Acid345_0904 xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41333"
FT                   /db_xref="GOA:D1CEH7"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEH7"
FT                   /inference="protein motif:TFAM:TIGR01312"
FT                   /protein_id="ACZ41333.1"
FT                   /translation="MPVVIGIDVGTTGVRVLAVDQSGNVVAESTSEYPLYTPRPGWTEQ
FT                   NPEDWWVATQESLHKVIQQVKDEILGLGLTGQMHGSVFLDERGDVIRPALLWNDQRTAK
FT                   QCEEMTEVVGYDKLISIAGNPALTGFQAPKILWLRENEPENYSKVRHVLLPKDYVRYKL
FT                   TGEFATDASDAAGTLLLDVKARDWSREILEALEIPLEWLPKVFEGPEVTGYVSQDLADS
FT                   LGLGSKIPVAAGGGDNAAAAVGTGIIKEGLMSSSIGTSGVLFVHSEEFRPDPSGRIHAF
FT                   CHAVPGKYHLMGVTLSAGGSLRWWRDLLGGLNYDQLSELASTAPPGSEGLLFLPYLTGE
FT                   RTPHLDPHARGSFFGLTARHDKSHMTRAVMEGVVFSMLDSLQIIRELNVEVNEVRAIGG
FT                   GARSQLWRQIQADIYRLPIKRTVAEEGPAYGAALLAGVASGIYKDVEEACSLIALRDEV
FT                   TYPDESRSDLYARYYEVYKSLYPSTKDAMHQLSELASM"
     MPVVIGIDVG TTGVRVLAVD QSGNVVAEST SEYPLYTPRP GWTEQNPEDW WVATQESLHK        60
     VIQQVKDEIL GLGLTGQMHG SVFLDERGDV IRPALLWNDQ RTAKQCEEMT EVVGYDKLIS       120
     IAGNPALTGF QAPKILWLRE NEPENYSKVR HVLLPKDYVR YKLTGEFATD ASDAAGTLLL       180
     DVKARDWSRE ILEALEIPLE WLPKVFEGPE VTGYVSQDLA DSLGLGSKIP VAAGGGDNAA       240
     AAVGTGIIKE GLMSSSIGTS GVLFVHSEEF RPDPSGRIHA FCHAVPGKYH LMGVTLSAGG       300
     SLRWWRDLLG GLNYDQLSEL ASTAPPGSEG LLFLPYLTGE RTPHLDPHAR GSFFGLTARH       360
     DKSHMTRAVM EGVVFSMLDS LQIIRELNVE VNEVRAIGGG ARSQLWRQIQ ADIYRLPIKR       420
     TVAEEGPAYG AALLAGVASG IYKDVEEACS LIALRDEVTY PDESRSDLYA RYYEVYKSLY       480
     PSTKDAMHQL SELASM                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page