(data stored in ACNUC7421 zone)

EMBL: CP001825.PE41

CP001825.PE41        Location/Qualifiers
FT   CDS             complement(42389..44989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0042"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mca:MCA1018 ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40965"
FT                   /db_xref="GOA:D1CDF9"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="InterPro:IPR038054"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDF9"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACZ40965.1"
FT                   /translation="METGQVRTLPSAFGLAKLSWNRNRLLLAGMLAFILLLLAASGIYA
FT                   IAYSGKIYPGVKVLGVDLSGKTKQEAARLLQSRADKLLESPVVLTADKHRFQVKSSDLG
FT                   VRFDIQAMVDSAYQFGRSDAFASRWLQRFMAPFSDHEVAPVVSLNNAKTRDTLESIAST
FT                   VDRPVRNAKIILGEDGPRFITSQVGVKLDIDSNLKSLSNSIPRAYEKSTTVSLKVIYTR
FT                   PSIEDSDLQPIYKGLVAAWNRPLTLKFGDKQWAMPVSEVRQLLRLDTSGKLPKPYLLEA
FT                   PIRNWLEDISQEIDSDPVDARIKVLSQSVELVPHKDGYTLLEDQTVERIQTEAFKSGII
FT                   DVVVQVTHPNLTTESLKPVVDKANAMVNQPFEVSYRNRSWTLEPQDLVQMLRWNKDDTP
FT                   PTPYISRNKLRTWLSGVAERIERSPVNARVIVDNGKVRIIPARIGVRLDIDANLKALIS
FT                   AISSGNTRQFALQVQRWEPKIRSSDLRPAVDLANQLISDPITVSYSSGNWNIDSTTLAS
FT                   WLRWEGNGKDITPVLDYDSVRSFVYQIAQQVNKDPSDAYLSVAGGYAHIVPETVGVTVD
FT                   IESTTQKIINAASTSTRNVTLDVTTSYPQVTSDDLKPALDKMLYWTGERFYMSLNGRTW
FT                   WLDPSDLVLALRWYGTGENTVVYLDENALEQQIRRWVPQDSVTDMDINYSATAQVAMKA
FT                   IVNGNRHIAIVAEPIKNDTSDQEHKGYESFWKGDFPDKWIDINLSSQSLAAYEGSKQVK
FT                   VSLITSGRPELPTPTGLFHVLSKISPKVFISPWPKDSEWYYPPSKANFALLFRSGGYYI
FT                   HDAPWRSVYGPGTNGSGPPGDARTGSHGCVNVPYSMMAWLYSWAEVGTPVLIHY"
     METGQVRTLP SAFGLAKLSW NRNRLLLAGM LAFILLLLAA SGIYAIAYSG KIYPGVKVLG        60
     VDLSGKTKQE AARLLQSRAD KLLESPVVLT ADKHRFQVKS SDLGVRFDIQ AMVDSAYQFG       120
     RSDAFASRWL QRFMAPFSDH EVAPVVSLNN AKTRDTLESI ASTVDRPVRN AKIILGEDGP       180
     RFITSQVGVK LDIDSNLKSL SNSIPRAYEK STTVSLKVIY TRPSIEDSDL QPIYKGLVAA       240
     WNRPLTLKFG DKQWAMPVSE VRQLLRLDTS GKLPKPYLLE APIRNWLEDI SQEIDSDPVD       300
     ARIKVLSQSV ELVPHKDGYT LLEDQTVERI QTEAFKSGII DVVVQVTHPN LTTESLKPVV       360
     DKANAMVNQP FEVSYRNRSW TLEPQDLVQM LRWNKDDTPP TPYISRNKLR TWLSGVAERI       420
     ERSPVNARVI VDNGKVRIIP ARIGVRLDID ANLKALISAI SSGNTRQFAL QVQRWEPKIR       480
     SSDLRPAVDL ANQLISDPIT VSYSSGNWNI DSTTLASWLR WEGNGKDITP VLDYDSVRSF       540
     VYQIAQQVNK DPSDAYLSVA GGYAHIVPET VGVTVDIEST TQKIINAAST STRNVTLDVT       600
     TSYPQVTSDD LKPALDKMLY WTGERFYMSL NGRTWWLDPS DLVLALRWYG TGENTVVYLD       660
     ENALEQQIRR WVPQDSVTDM DINYSATAQV AMKAIVNGNR HIAIVAEPIK NDTSDQEHKG       720
     YESFWKGDFP DKWIDINLSS QSLAAYEGSK QVKVSLITSG RPELPTPTGL FHVLSKISPK       780
     VFISPWPKDS EWYYPPSKAN FALLFRSGGY YIHDAPWRSV YGPGTNGSGP PGDARTGSHG       840
     CVNVPYSMMA WLYSWAEVGT PVLIHY                                            866
//

If you have problems or comments...

PBIL Back to PBIL home page