(data stored in ACNUC7421 zone)

EMBL: CP001825.PE410

CP001825.PE410       Location/Qualifiers
FT   CDS             complement(441864..442601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0412"
FT                   /product="6-phosphogluconolactonase"
FT                   /note="TIGRFAM: 6-phosphogluconolactonase; PFAM:
FT                   glucosamine/galactosamine-6-phosphate isomerase; KEGG:
FT                   dvu:DVU2313 6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41334"
FT                   /db_xref="GOA:D1CEH8"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEH8"
FT                   /inference="protein motif:TFAM:TIGR01198"
FT                   /protein_id="ACZ41334.1"
FT                   /translation="MAGKLSIVENSSEVARAGAEQFISRAKESIDDHGSFFVALSGGST
FT                   PVAMYKLLASDEYRGKVDWDKVLFFWSDERCVPPDHPDSNYGSAHQHLLQPLGITEDRV
FT                   FRMKGELPPEEAAREYEEIVKKAVPGDPPRFDLIFLGLGDDAHTASLFPETDALHVTDR
FT                   LVVHNYVPKLNTYRITFTSTLINAAASVVFLVSGEGKAEALKSVLEGEQNPTKYPAQMV
FT                   NPTSGALLWVVDRAAASLLSGTQ"
     MAGKLSIVEN SSEVARAGAE QFISRAKESI DDHGSFFVAL SGGSTPVAMY KLLASDEYRG        60
     KVDWDKVLFF WSDERCVPPD HPDSNYGSAH QHLLQPLGIT EDRVFRMKGE LPPEEAAREY       120
     EEIVKKAVPG DPPRFDLIFL GLGDDAHTAS LFPETDALHV TDRLVVHNYV PKLNTYRITF       180
     TSTLINAAAS VVFLVSGEGK AEALKSVLEG EQNPTKYPAQ MVNPTSGALL WVVDRAAASL       240
     LSGTQ                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page