(data stored in ACNUC7421 zone)

EMBL: CP001825.PE412

CP001825.PE412       Location/Qualifiers
FT   CDS             complement(447127..449001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0415"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: scl:sce8467 transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41336"
FT                   /db_xref="GOA:D1CEI0"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEI0"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ACZ41336.1"
FT                   /translation="MAVTTDQKTQIEQWHELAQQLRVDSLRCSTEAGSGHPTSSMSAAD
FT                   LMAVLMSKYLRYDFNNPENPGNDHLIFSKGHASPLLYSMFKAAGAITDEELMTFRKFGS
FT                   RLQGHPTPAIPWVDVATGSLGQGLPIAIGIALSGKYLEKLPYRVWVLCGDSEMAEGSMW
FT                   EAFQHAGYYKLDNLIAIVDVNRLGQRGETMLGWNLDGYAERAKAFGWHVIEIDGHNLEE
FT                   IDRAYEEAIQVTGQPTVILARTHKGRGVSFLEDKEGWHGKPIDKDSLPKAIEELGGERN
FT                   ITIEVPKPDPVEAPSRGENKPLELPKYEVGDSVATRGAYGDALKALGAARGDVVALDGE
FT                   VSNSTYSERFAKAYPDRFFEMYIAEQQMVAAAIGLGVRKWVPFASTFAAFLTRAYDFIR
FT                   MGAISRANIRLCGSHAGVSIGEDGPSQMGLEDIAMMRAVHGSTVLYPCDANQTAQLVAA
FT                   MADQNGISFLRTTREKTPVIYSSDEEFKIGGSKVVKQSSNDVATVVAAGITVHEAIKAY
FT                   EELQKEGVSIRIVDAYSVKPIDVATLIESLQATGGKLVIAEDHWPEGGLGEAVLSALAD
FT                   SGQVSLSDIKVKHLAVRDMPGSGKPQELLDAAGISAKHIANAVRELSK"
     MAVTTDQKTQ IEQWHELAQQ LRVDSLRCST EAGSGHPTSS MSAADLMAVL MSKYLRYDFN        60
     NPENPGNDHL IFSKGHASPL LYSMFKAAGA ITDEELMTFR KFGSRLQGHP TPAIPWVDVA       120
     TGSLGQGLPI AIGIALSGKY LEKLPYRVWV LCGDSEMAEG SMWEAFQHAG YYKLDNLIAI       180
     VDVNRLGQRG ETMLGWNLDG YAERAKAFGW HVIEIDGHNL EEIDRAYEEA IQVTGQPTVI       240
     LARTHKGRGV SFLEDKEGWH GKPIDKDSLP KAIEELGGER NITIEVPKPD PVEAPSRGEN       300
     KPLELPKYEV GDSVATRGAY GDALKALGAA RGDVVALDGE VSNSTYSERF AKAYPDRFFE       360
     MYIAEQQMVA AAIGLGVRKW VPFASTFAAF LTRAYDFIRM GAISRANIRL CGSHAGVSIG       420
     EDGPSQMGLE DIAMMRAVHG STVLYPCDAN QTAQLVAAMA DQNGISFLRT TREKTPVIYS       480
     SDEEFKIGGS KVVKQSSNDV ATVVAAGITV HEAIKAYEEL QKEGVSIRIV DAYSVKPIDV       540
     ATLIESLQAT GGKLVIAEDH WPEGGLGEAV LSALADSGQV SLSDIKVKHL AVRDMPGSGK       600
     PQELLDAAGI SAKHIANAVR ELSK                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page