(data stored in ACNUC7421 zone)

EMBL: CP001825.PE413

CP001825.PE413       Location/Qualifiers
FT   CDS             complement(449118..450512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0416"
FT                   /product="carbohydrate kinase FGGY"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG: bat:BAS3177
FT                   gluconate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41337"
FT                   /db_xref="GOA:D1CEI1"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEI1"
FT                   /inference="protein motif:PFAM:PF00370"
FT                   /protein_id="ACZ41337.1"
FT                   /translation="MSHKPSEPCVLSIDIGTSSIRSCLIDATGDIADNTLFAIEHSPTT
FT                   TPDGGSELDPEEAFTKVCAVIDKSLSAAREYSVLPAAVAMTSFWHSLMGIDHRGKAITP
FT                   VYLWADTRSAPYVDQLRSEASVDETYKRNGCPLHSSYWPSKLLWLRDSRPELYSQVDKW
FT                   LSFAEYVQLRFTGELRCAHGMASGTGIYLQREMSWDPFWIDLLDLRENSLPRLTSLREP
FT                   LGYLRVSDFPWKDLAGIPWYPAVGDGACSNIGSGAFDSSKVAINFGTSGAIRIVVDQYL
FT                   EPPYGLWLYRIDKDRLLFGGALSNAGNIYEWLTETLRISHEQAEQCLLTIQKVKPGLVF
FT                   EPYLAGERSPRWRPDATGTIRGLRLDTKPEDIFKAGMLGVLYEFAKVHDMLDNSLGSDD
FT                   RVTLLSGGAIIKSQALRKALSEVLRRPTMICLEEEPSARGAALLVLEAIGAVKELKDAP
FT                   TRLVAP"
     MSHKPSEPCV LSIDIGTSSI RSCLIDATGD IADNTLFAIE HSPTTTPDGG SELDPEEAFT        60
     KVCAVIDKSL SAAREYSVLP AAVAMTSFWH SLMGIDHRGK AITPVYLWAD TRSAPYVDQL       120
     RSEASVDETY KRNGCPLHSS YWPSKLLWLR DSRPELYSQV DKWLSFAEYV QLRFTGELRC       180
     AHGMASGTGI YLQREMSWDP FWIDLLDLRE NSLPRLTSLR EPLGYLRVSD FPWKDLAGIP       240
     WYPAVGDGAC SNIGSGAFDS SKVAINFGTS GAIRIVVDQY LEPPYGLWLY RIDKDRLLFG       300
     GALSNAGNIY EWLTETLRIS HEQAEQCLLT IQKVKPGLVF EPYLAGERSP RWRPDATGTI       360
     RGLRLDTKPE DIFKAGMLGV LYEFAKVHDM LDNSLGSDDR VTLLSGGAII KSQALRKALS       420
     EVLRRPTMIC LEEEPSARGA ALLVLEAIGA VKELKDAPTR LVAP                        464
//

If you have problems or comments...

PBIL Back to PBIL home page