(data stored in ACNUC7421 zone)

EMBL: CP001825.PE414

CP001825.PE414       Location/Qualifiers
FT   CDS             450594..451103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0417"
FT                   /product="adenylate cyclase"
FT                   /note="PFAM: adenylate cyclase; KEGG: dvm:DvMF_0460
FT                   adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41338"
FT                   /db_xref="InterPro:IPR008173"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEI2"
FT                   /inference="protein motif:PFAM:PF01928"
FT                   /protein_id="ACZ41338.1"
FT                   /translation="MRETEIKLRVENLEEVEERLRRVGAMPREERVEEVDRIFRDVTGD
FT                   RLESQLLRLRTSAGKNTLTWKGEPKFRGGVKEREEEQTGVESAEAMIEILRRLGFEVDL
FT                   EFSKVRNYWELEGCMVSLDTLPFGRFIEIEGDEAAIVRVRRILELEAAEEVKLSYPEMA
FT                   RIHLGK"
     MRETEIKLRV ENLEEVEERL RRVGAMPREE RVEEVDRIFR DVTGDRLESQ LLRLRTSAGK        60
     NTLTWKGEPK FRGGVKEREE EQTGVESAEA MIEILRRLGF EVDLEFSKVR NYWELEGCMV       120
     SLDTLPFGRF IEIEGDEAAI VRVRRILELE AAEEVKLSYP EMARIHLGK                   169
//

If you have problems or comments...

PBIL Back to PBIL home page