(data stored in ACNUC7421 zone)

EMBL: CP001825.PE419

CP001825.PE419       Location/Qualifiers
FT   CDS             456772..458190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0422"
FT                   /product="fumarate lyase"
FT                   /note="PFAM: fumarate lyase; KEGG: pca:Pcar_0324 fumarate
FT                   hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41343"
FT                   /db_xref="GOA:D1CEI7"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEI7"
FT                   /inference="protein motif:PFAM:PF00206"
FT                   /protein_id="ACZ41343.1"
FT                   /translation="MTDGRFRIERDSMGEVRVPADAYYGAQTQRAVENFPISDLRFPRR
FT                   FIKALGQIKMAAAEVNADLGLLDPEIARAIVQAAQEVIEGKMDSQFVVDIFQTGSGTST
FT                   NMNANEVIANRAIELLGGEIGTKSPVHPNDHVNLGQSSNDVIPTAIHVSTLSAIQEDLE
FT                   PALSELLAALREKSVEFMPIIKTGRTHLQDATPIRLGQEFEGYAGQVERALQRLSYAKA
FT                   ELSEVALGGTAVGTGINTHPEFARRVCEKLSQLNGFEIRETTNHFQAQSSLDACVLTSG
FT                   VLKTIAVSLMKIANDIRWLGSGPRAGIGELELPEVQPGSSIMPGKVNPVIAESLLMVCA
FT                   QVIGSDAVVATGGQWGNFELNTMMPVVAYNLLQSVEIMASASSNFARKCVRGLRATERG
FT                   PQLVEQGLAICTALAPEIGYDAAAKIAQEAHRTGRTIREVARERTQLSDEELDRILNPE
FT                   VMTEPGRNIGPAGG"
     MTDGRFRIER DSMGEVRVPA DAYYGAQTQR AVENFPISDL RFPRRFIKAL GQIKMAAAEV        60
     NADLGLLDPE IARAIVQAAQ EVIEGKMDSQ FVVDIFQTGS GTSTNMNANE VIANRAIELL       120
     GGEIGTKSPV HPNDHVNLGQ SSNDVIPTAI HVSTLSAIQE DLEPALSELL AALREKSVEF       180
     MPIIKTGRTH LQDATPIRLG QEFEGYAGQV ERALQRLSYA KAELSEVALG GTAVGTGINT       240
     HPEFARRVCE KLSQLNGFEI RETTNHFQAQ SSLDACVLTS GVLKTIAVSL MKIANDIRWL       300
     GSGPRAGIGE LELPEVQPGS SIMPGKVNPV IAESLLMVCA QVIGSDAVVA TGGQWGNFEL       360
     NTMMPVVAYN LLQSVEIMAS ASSNFARKCV RGLRATERGP QLVEQGLAIC TALAPEIGYD       420
     AAAKIAQEAH RTGRTIREVA RERTQLSDEE LDRILNPEVM TEPGRNIGPA GG               472
//

If you have problems or comments...

PBIL Back to PBIL home page