(data stored in ACNUC7421 zone)

EMBL: CP001825.PE420

CP001825.PE420       Location/Qualifiers
FT   CDS             complement(458217..459236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0423"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /EC_number="3.1.3.26"
FT                   /note="KEGG: bsu:BSU29530 signal peptide peptidase;
FT                   TIGRFAM: signal peptide peptidase SppA, 36K type; PFAM:
FT                   peptidase S49"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41344"
FT                   /db_xref="GOA:D1CEI8"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEI8"
FT                   /inference="protein motif:TFAM:TIGR00706"
FT                   /protein_id="ACZ41344.1"
FT                   /translation="METPAQPQHQTQPQPQPRKRSWIPIVVFLSALVVACVACVALAVL
FT                   MGRSVESTAESIHEEAVQGSGEWKIAIIPVTGTIQESAGGFTTSAATPESLKAMLDQAE
FT                   NDSKVKAIILEVDSPGGEVVASDEMYREILDFKQRTRKPVVVRMVSTAASGAYYISMAA
FT                   DKIVANPMTLTGSLGVIMEYMNFSKAADKVGISQVVIRSGEFKDIGNPFRDPTKEERQI
FT                   LQQLVDEAYNQFVNVIAQGRKMPTSRVRQLADGRVYSGQQAKQLGLVDELGNLDKAVQV
FT                   AEQLAGIKNAQVVRYRHSVSLLSLLSSRLQMSTEPDAMKILRSAGYDITPRLMYIYRP"
     METPAQPQHQ TQPQPQPRKR SWIPIVVFLS ALVVACVACV ALAVLMGRSV ESTAESIHEE        60
     AVQGSGEWKI AIIPVTGTIQ ESAGGFTTSA ATPESLKAML DQAENDSKVK AIILEVDSPG       120
     GEVVASDEMY REILDFKQRT RKPVVVRMVS TAASGAYYIS MAADKIVANP MTLTGSLGVI       180
     MEYMNFSKAA DKVGISQVVI RSGEFKDIGN PFRDPTKEER QILQQLVDEA YNQFVNVIAQ       240
     GRKMPTSRVR QLADGRVYSG QQAKQLGLVD ELGNLDKAVQ VAEQLAGIKN AQVVRYRHSV       300
     SLLSLLSSRL QMSTEPDAMK ILRSAGYDIT PRLMYIYRP                              339
//

If you have problems or comments...

PBIL Back to PBIL home page