(data stored in ACNUC7421 zone)

EMBL: CP001825.PE421

CP001825.PE421       Location/Qualifiers
FT   CDS             complement(459249..459908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0424"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpt:Bpet0646 DMT superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41345"
FT                   /db_xref="GOA:D1CEI9"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEI9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41345.1"
FT                   /translation="METLRILWAPNEEFPRLLKAGGTRWAVGTVSLLAFLNLITTLINL
FT                   NSGVLQLEQQYFPDVPRDVLQATQQAMKVLTPVAAATYPFITWLVLGVLMYLTGRVFGG
FT                   TGRLSSMLVVSGVSQLPLIVGLVAGSVLAAAASTTSPDSPAAAFLGSLSFSLLIGQFMW
FT                   MAWLAVTGIRHVHQLDPRKSTASCGLSCLGCLGVFFILMFVAAIILSLVITTRVSS"
     METLRILWAP NEEFPRLLKA GGTRWAVGTV SLLAFLNLIT TLINLNSGVL QLEQQYFPDV        60
     PRDVLQATQQ AMKVLTPVAA ATYPFITWLV LGVLMYLTGR VFGGTGRLSS MLVVSGVSQL       120
     PLIVGLVAGS VLAAAASTTS PDSPAAAFLG SLSFSLLIGQ FMWMAWLAVT GIRHVHQLDP       180
     RKSTASCGLS CLGCLGVFFI LMFVAAIILS LVITTRVSS                              219
//

If you have problems or comments...

PBIL Back to PBIL home page