(data stored in ACNUC7421 zone)

EMBL: CP001825.PE423

CP001825.PE423       Location/Qualifiers
FT   CDS             complement(461080..462225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0426"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: vpa:VP0252 DNA-binding transcriptional
FT                   regulator CytR; PFAM: regulatory protein LacI; periplasmic
FT                   binding protein/LacI transcriptional regulator; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41347"
FT                   /db_xref="GOA:D1CEJ1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEJ1"
FT                   /inference="protein motif:PRIAM:5.1.1.1"
FT                   /protein_id="ACZ41347.1"
FT                   /translation="MPRSDQIDDKQNKLGKARRFQGASLRDVAKLAGVSVKTVSNVVNN
FT                   YPHVTEETRMRVQRALEELNYRPNLSARNLRNGKSGLIALAVPEIDFPYFSELARLVIK
FT                   VAGERGYTVLIDQTGGARDREKLVLAGIRPQMVDGIIFSPIETGKEDLLERRDDTPLVL
FT                   LGEGATDGILDHVGIDNVKAARVAVRHLLDLGRRRIAAIGAQPGVVVQTGHLRLRGYYE
FT                   ALQEAGIGIDQDLIARAPVYHRHEGAEAMRKLLELKDPPDAVFCFNDLLALGAIRTLIN
FT                   FGLRVPEDVAVVGFDDIEEASYSNPTLTSISPNKEQIARIAMSMLISRMEEGTTTPPRE
FT                   EQVDFRLIARESTLGVRCQEQVVYDSLQEDKARNNSALMEG"
     MPRSDQIDDK QNKLGKARRF QGASLRDVAK LAGVSVKTVS NVVNNYPHVT EETRMRVQRA        60
     LEELNYRPNL SARNLRNGKS GLIALAVPEI DFPYFSELAR LVIKVAGERG YTVLIDQTGG       120
     ARDREKLVLA GIRPQMVDGI IFSPIETGKE DLLERRDDTP LVLLGEGATD GILDHVGIDN       180
     VKAARVAVRH LLDLGRRRIA AIGAQPGVVV QTGHLRLRGY YEALQEAGIG IDQDLIARAP       240
     VYHRHEGAEA MRKLLELKDP PDAVFCFNDL LALGAIRTLI NFGLRVPEDV AVVGFDDIEE       300
     ASYSNPTLTS ISPNKEQIAR IAMSMLISRM EEGTTTPPRE EQVDFRLIAR ESTLGVRCQE       360
     QVVYDSLQED KARNNSALME G                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page