(data stored in ACNUC7421 zone)

EMBL: CP001825.PE426

CP001825.PE426       Location/Qualifiers
FT   CDS             465165..466028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0429"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: atc:AGR_L_460 lactose
FT                   transport system permease protein lacG"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41350"
FT                   /db_xref="GOA:D1CEJ4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEJ4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACZ41350.1"
FT                   /translation="MASAIAKVSFRRISLELVITYVYLIALGIITLAPIAYMVSQAFTP
FT                   EADQNQWPVRWLPEHPTVNNFQRLLADPTLPVLRWLFNSFFVSTSVMLLTLLLCSLAAY
FT                   AFARLEFPGRDVIFFIILISLMIPGAVTFIPVFLLMRDLKFLDTYNALIWPAGANAFGV
FT                   FMLRQYFITIPKELEEAALVDGANRFRIYWQIALPLVSPALVALGIFTFLGSWNDLFWP
FT                   LVVLSERTMYTLPVGLAFLGQGNYVQQGLTMAAATLASAPVLIVYAIFQRRIVQGIALT
FT                   GGLGGR"
     MASAIAKVSF RRISLELVIT YVYLIALGII TLAPIAYMVS QAFTPEADQN QWPVRWLPEH        60
     PTVNNFQRLL ADPTLPVLRW LFNSFFVSTS VMLLTLLLCS LAAYAFARLE FPGRDVIFFI       120
     ILISLMIPGA VTFIPVFLLM RDLKFLDTYN ALIWPAGANA FGVFMLRQYF ITIPKELEEA       180
     ALVDGANRFR IYWQIALPLV SPALVALGIF TFLGSWNDLF WPLVVLSERT MYTLPVGLAF       240
     LGQGNYVQQG LTMAAATLAS APVLIVYAIF QRRIVQGIAL TGGLGGR                     287
//

If you have problems or comments...

PBIL Back to PBIL home page