(data stored in ACNUC7421 zone)

EMBL: CP001825.PE428

CP001825.PE428       Location/Qualifiers
FT   CDS             468968..470593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5756 TolB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41352"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEJ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41352.1"
FT                   /translation="MRAKTCTISALLHALVVLALLVSSCGGGNTSAGGAEKNMSQAPKV
FT                   STPTRLPSDSGTVGTPTTSPTKVVSQEPPSNGGANTGGSDLEGGSSDDAGNSNGEIGNG
FT                   SGQPIKDPVQTGSNSVVGKGSSDSGSGEETSLEKPYRPTKPKLQIPKPGPEYKIQLKIE
FT                   GYTTYVFAVRNGVRRVVLTEPARYFPGMFEKYIRLSPDNRTLTYAVSVKSHSPRMKMYT
FT                   IGIDGRNRRLIGDFPWQLWVASPVWSPDSKQIAYVVASGPGQEPGIELWVMNADGSNKH
FT                   RVVKDPSFNTSLFYGNVQNPIRWTPYGDLQYLDYNSGKIWTVDTTTGELSYRTADLKAP
FT                   QSDIPLIKSKYPIPIQSQNDPRWRFDIIRTCSDTMGNSGCAITVVSMSFNAYGIKTDPR
FT                   KLNKDLGRNACPIYWTWASKYFSEGKLELWGVWAFDWYSLDLALSMGRPAMVWLSDGLT
FT                   LDTSLLSHWVLVVGGSGHTPDGYRIYDPWDGTTYKTLAYYTSKGYGLTRVYVYAPKQPK
FT                   KPKTERSKNSSSGEQRQSKDSKRD"
     MRAKTCTISA LLHALVVLAL LVSSCGGGNT SAGGAEKNMS QAPKVSTPTR LPSDSGTVGT        60
     PTTSPTKVVS QEPPSNGGAN TGGSDLEGGS SDDAGNSNGE IGNGSGQPIK DPVQTGSNSV       120
     VGKGSSDSGS GEETSLEKPY RPTKPKLQIP KPGPEYKIQL KIEGYTTYVF AVRNGVRRVV       180
     LTEPARYFPG MFEKYIRLSP DNRTLTYAVS VKSHSPRMKM YTIGIDGRNR RLIGDFPWQL       240
     WVASPVWSPD SKQIAYVVAS GPGQEPGIEL WVMNADGSNK HRVVKDPSFN TSLFYGNVQN       300
     PIRWTPYGDL QYLDYNSGKI WTVDTTTGEL SYRTADLKAP QSDIPLIKSK YPIPIQSQND       360
     PRWRFDIIRT CSDTMGNSGC AITVVSMSFN AYGIKTDPRK LNKDLGRNAC PIYWTWASKY       420
     FSEGKLELWG VWAFDWYSLD LALSMGRPAM VWLSDGLTLD TSLLSHWVLV VGGSGHTPDG       480
     YRIYDPWDGT TYKTLAYYTS KGYGLTRVYV YAPKQPKKPK TERSKNSSSG EQRQSKDSKR       540
     D                                                                       541
//

If you have problems or comments...

PBIL Back to PBIL home page