(data stored in ACNUC7421 zone)

EMBL: CP001825.PE430

CP001825.PE430       Location/Qualifiers
FT   CDS             472820..473836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0433"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   bcb:BCB4264_A2807 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41354"
FT                   /db_xref="GOA:D1CEJ8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEJ8"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACZ41354.1"
FT                   /translation="MIPVYTEVPTGPKITLSDQDLAVIAQNYGLGAILDKKLLNGAVNT
FT                   IVLLKTSQGAFVARAHRPWTTAERLESVHTVMQSLKDRGFPVPKVGRTLDDRTWIQIRD
FT                   RLVELQEYIPHDACIDSWDLYMHSFEILAKMHEYLLTLHVDHLFPPLVSTYVTPEQALK
FT                   MLEDTDAICVEKARELGAEDALHIRQQARDILEALDREWKGYADRLPRQVVHGDYGWSN
FT                   VLVKGGRIVGIIDFDFMAERERVFEVAYSLYWAFDRLEGDNWQNGFFPRVGRLVDRYNY
FT                   LSRWPLLDVEISVLPYEMARVPLYWIAEAGYTPDPIGQIMLYSRHLPKARKLLELAG"
     MIPVYTEVPT GPKITLSDQD LAVIAQNYGL GAILDKKLLN GAVNTIVLLK TSQGAFVARA        60
     HRPWTTAERL ESVHTVMQSL KDRGFPVPKV GRTLDDRTWI QIRDRLVELQ EYIPHDACID       120
     SWDLYMHSFE ILAKMHEYLL TLHVDHLFPP LVSTYVTPEQ ALKMLEDTDA ICVEKARELG       180
     AEDALHIRQQ ARDILEALDR EWKGYADRLP RQVVHGDYGW SNVLVKGGRI VGIIDFDFMA       240
     ERERVFEVAY SLYWAFDRLE GDNWQNGFFP RVGRLVDRYN YLSRWPLLDV EISVLPYEMA       300
     RVPLYWIAEA GYTPDPIGQI MLYSRHLPKA RKLLELAG                               338
//

If you have problems or comments...

PBIL Back to PBIL home page