(data stored in ACNUC7421 zone)

EMBL: CP001825.PE432

CP001825.PE432       Location/Qualifiers
FT   CDS             complement(475120..475818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0435"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; SH3 type 3 domain protein;
FT                   SMART: SH3 domain protein; KEGG: bcy:Bcer98_1493 NLP/P60
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41356"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEK0"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ACZ41356.1"
FT                   /translation="MIRKILGLFLALVVAFVSLSFVSPTSEAAYVRPGSYATTTANLNL
FT                   RSGPSTYYYVKRVIPYGGRVYVLSGPYNRYWYKVRWSGTVGYVHGYYLRSGSTVRTTSY
FT                   YYSSKGQAIANTAKRYVGYRYAYYGNTPAEGFSCVGFTQWVYRLNGIWIPESLWGQYSM
FT                   GWGVSRSNLRPGDLVFFQNTFWRGLSHAGIYVGNGWMIDSGTPQTGVHWSYIYDSYWRY
FT                   RWFGARRLVN"
     MIRKILGLFL ALVVAFVSLS FVSPTSEAAY VRPGSYATTT ANLNLRSGPS TYYYVKRVIP        60
     YGGRVYVLSG PYNRYWYKVR WSGTVGYVHG YYLRSGSTVR TTSYYYSSKG QAIANTAKRY       120
     VGYRYAYYGN TPAEGFSCVG FTQWVYRLNG IWIPESLWGQ YSMGWGVSRS NLRPGDLVFF       180
     QNTFWRGLSH AGIYVGNGWM IDSGTPQTGV HWSYIYDSYW RYRWFGARRL VN               232
//

If you have problems or comments...

PBIL Back to PBIL home page