(data stored in ACNUC7421 zone)

EMBL: CP001825.PE433

CP001825.PE433       Location/Qualifiers
FT   CDS             complement(476684..477154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0436"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="TIGRFAM: D-tyrosyl-tRNA(Tyr) deacylase; PFAM:
FT                   D-tyrosyl-tRNA(Tyr) deacylase; KEGG: ade:Adeh_0179
FT                   D-tyrosyl-tRNA deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41357"
FT                   /db_xref="GOA:D1CEK1"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEK1"
FT                   /inference="protein motif:TFAM:TIGR00256"
FT                   /protein_id="ACZ41357.1"
FT                   /translation="MKILLQRVSRAEVRVDGSRVAKIDRGLLLFVGIAQDDDPEVIAPM
FT                   AEKVANLRIFEDEQGKMNLSALQVGAAILVVSQFTLLADARKGRRPSFIEAAPPDRASA
FT                   FIDCMVSCFRDMGFEVQTGRFGAHMEVELVNDGPVTIMLDSREILRRQTTID"
     MKILLQRVSR AEVRVDGSRV AKIDRGLLLF VGIAQDDDPE VIAPMAEKVA NLRIFEDEQG        60
     KMNLSALQVG AAILVVSQFT LLADARKGRR PSFIEAAPPD RASAFIDCMV SCFRDMGFEV       120
     QTGRFGAHME VELVNDGPVT IMLDSREILR RQTTID                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page