(data stored in ACNUC7421 zone)

EMBL: CP001825.PE435

CP001825.PE435       Location/Qualifiers
FT   CDS             477660..479465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0438"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: bba:Bd2027 hypothetical protein; TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41359"
FT                   /db_xref="GOA:D1CEK3"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEK3"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ACZ41359.1"
FT                   /translation="MLQQEISQAKEAIREAIAQLGLPQPENIDLRQIPFSGQWGLATSV
FT                   CHQLARNEVQVDIPEGLSKKEARKLLEAASRERAQSLAESIANYLSRKGIFADVQAQNG
FT                   YVNMFFEPSDVALRLLATVHEQGDSYGRGNPKSETVMVEYGQPNTHKQFHIGHLRNTAL
FT                   GDSIARILDFAGYRKVLKASYIGDIGAHVIKWLWGYNKWHSGEQPPADPYKIGPWLESI
FT                   YVEANSAIESNPDYQREYRDLFARWDRRDPEVVELWRRTREWSLNYFRRIFKELDVNFD
FT                   VWFYESDFEEPGKKIVQDLLNKGVAEIDEGAPIVRIDQKLGLEKETYRTIVLQRSDGTS
FT                   LYQTKELALTRTKFDEYKVDRILNVVDVRQTLYFQQVFKVLELLGYEQARNSQHIPYEL
FT                   VSLPTGPMSSREGTTVGYDEFATEMYERALEVVREKNPEMPQEQQERIARIVSMGSMKF
FT                   GMLNRDNTRVLVFDKEEALDFDGFSAPYVQYAHARACRILEKAPDIDWENLRIGELSTV
FT                   ETNLLEMISRLNESVERAAREYKPLHVVNYVYELAKTFNEFYRVSPVLRAEEEVRNFRL
FT                   AVVYATKVCLANSLYLLGIEAPEVM"
     MLQQEISQAK EAIREAIAQL GLPQPENIDL RQIPFSGQWG LATSVCHQLA RNEVQVDIPE        60
     GLSKKEARKL LEAASRERAQ SLAESIANYL SRKGIFADVQ AQNGYVNMFF EPSDVALRLL       120
     ATVHEQGDSY GRGNPKSETV MVEYGQPNTH KQFHIGHLRN TALGDSIARI LDFAGYRKVL       180
     KASYIGDIGA HVIKWLWGYN KWHSGEQPPA DPYKIGPWLE SIYVEANSAI ESNPDYQREY       240
     RDLFARWDRR DPEVVELWRR TREWSLNYFR RIFKELDVNF DVWFYESDFE EPGKKIVQDL       300
     LNKGVAEIDE GAPIVRIDQK LGLEKETYRT IVLQRSDGTS LYQTKELALT RTKFDEYKVD       360
     RILNVVDVRQ TLYFQQVFKV LELLGYEQAR NSQHIPYELV SLPTGPMSSR EGTTVGYDEF       420
     ATEMYERALE VVREKNPEMP QEQQERIARI VSMGSMKFGM LNRDNTRVLV FDKEEALDFD       480
     GFSAPYVQYA HARACRILEK APDIDWENLR IGELSTVETN LLEMISRLNE SVERAAREYK       540
     PLHVVNYVYE LAKTFNEFYR VSPVLRAEEE VRNFRLAVVY ATKVCLANSL YLLGIEAPEV       600
     M                                                                       601
//

If you have problems or comments...

PBIL Back to PBIL home page