(data stored in ACNUC7421 zone)

EMBL: CP001825.PE436

CP001825.PE436       Location/Qualifiers
FT   CDS             479470..480756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0439"
FT                   /product="Arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="PFAM: amidinotransferase; KEGG: bcy:Bcer98_0348
FT                   arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41360"
FT                   /db_xref="GOA:D1CEK4"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEK4"
FT                   /inference="protein motif:PRIAM:3.5.3.6"
FT                   /protein_id="ACZ41360.1"
FT                   /translation="MSSLQVSSESGVLRKALVHTPGGELSMVAPSRLRDFLFSDILYEK
FT                   GAREEHLTLVKVLREIFNVEVLQFTALLEEALSSSDPLDKLRLVEGVSDLEGLHAEDTI
FT                   KLKAAFEDESQNDASYLARLLITGKLVGSDLSISDFIRHNLYQLQPVPNLMFVRDLAAV
FT                   IGQEMFVGWNSQKVRRRENLLWRFILQHASIGQDITWHNWMMEDENSSPCYLEGGNILQ
FT                   PRPNILLIGHGVRTNSSAVERLIRHLQNVMEDTCYLFVIMLPDYIPHLDAVLSAISPFE
FT                   YVAFPPAVKGHSQYSVDVLQVVLQQGKQPKTQVVDLLDSLQSTIGEPLDIIPCGGSDTV
FT                   TQKREYWWGGASLLTVSPGKIISYNSPENTLNELSKRGYKIIQATDALSNPDSIRSCER
FT                   CVITLRGLELTRARGGPRSLVMPLVREGV"
     MSSLQVSSES GVLRKALVHT PGGELSMVAP SRLRDFLFSD ILYEKGAREE HLTLVKVLRE        60
     IFNVEVLQFT ALLEEALSSS DPLDKLRLVE GVSDLEGLHA EDTIKLKAAF EDESQNDASY       120
     LARLLITGKL VGSDLSISDF IRHNLYQLQP VPNLMFVRDL AAVIGQEMFV GWNSQKVRRR       180
     ENLLWRFILQ HASIGQDITW HNWMMEDENS SPCYLEGGNI LQPRPNILLI GHGVRTNSSA       240
     VERLIRHLQN VMEDTCYLFV IMLPDYIPHL DAVLSAISPF EYVAFPPAVK GHSQYSVDVL       300
     QVVLQQGKQP KTQVVDLLDS LQSTIGEPLD IIPCGGSDTV TQKREYWWGG ASLLTVSPGK       360
     IISYNSPENT LNELSKRGYK IIQATDALSN PDSIRSCERC VITLRGLELT RARGGPRSLV       420
     MPLVREGV                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page