(data stored in ACNUC7421 zone)

EMBL: CP001825.PE438

CP001825.PE438       Location/Qualifiers
FT   CDS             complement(482049..484493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0441"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_5677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41362"
FT                   /db_xref="GOA:D1CEK6"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEK6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41362.1"
FT                   /translation="MKNSLVAIFATALLCLTVLTTPSVKAVGDYGNVEGRVTYNGLPVK
FT                   GASISAGGQSVISDSQGRFRFDPLLVQDSWRAINVTVRASGLGVWRLYNAVIIPNDTLR
FT                   LDVKLSKHDVTLSQPLPGTTKNNLAPSKVSPEQDQNLKPAATTLGSQKVPPGVIRVYVT
FT                   DKTGLSPEDMWSCRYDPVPKGEVVEVPFKDYVKHVLPNEWFASWDMESLRAGAMAVKSY
FT                   AWYYVSRGGKWYWLGADVMDTTCDQVYNPAVSYASTDQAVENTWYQRLTENGYIVPAFY
FT                   RAGTKGDPGEQGSDVMSQWGSQYWATKGKTWDWILHYYYDPVDILPATEADLRIYSGPN
FT                   VTSTTPTWGEPFNVKVTVKNYGSEPMQLQELYIKLRGPNGEILDLGGDDNSNPIDPGEV
FT                   RTISKYVPRLAIDYPGLYGNYVLTVTYIDPGGFLAPGLPPGESSTSTSIPLTVVAPSYK
FT                   AQIYSITPDSPSYYEQTTGSLTVKLRNTGNATWYKNSSSIQNAVRLVTYNDAFHPSRFY
FT                   VEGSWLSSSRILMQDSLVMPGGIGTFRFKLNGDLPPGNYTEYFRLRVEGSFGSTYRGFF
FT                   GDQVAVNISVLDDSTPPSITINAPRYSTERSSELSFPISWQGNDEQTGVKDYDIYWKNG
FT                   TDYVPWKSATSSTSATFGNGDPINLAQGGNYLFRLRAEDIAGNVSSWRNFRVIVPFDDT
FT                   RFSYNSGWRSYYNPYARHYLHTYHYAYSYGRQATFSFYGRRVAWIGVKGPTRGMAEVWI
FT                   DGSRIATVDLYAPRYSTRTVVFEKSLGTRNARHTITIKVLGKRNQLSTSNRVDIDGIAV
FT                   LR"
     MKNSLVAIFA TALLCLTVLT TPSVKAVGDY GNVEGRVTYN GLPVKGASIS AGGQSVISDS        60
     QGRFRFDPLL VQDSWRAINV TVRASGLGVW RLYNAVIIPN DTLRLDVKLS KHDVTLSQPL       120
     PGTTKNNLAP SKVSPEQDQN LKPAATTLGS QKVPPGVIRV YVTDKTGLSP EDMWSCRYDP       180
     VPKGEVVEVP FKDYVKHVLP NEWFASWDME SLRAGAMAVK SYAWYYVSRG GKWYWLGADV       240
     MDTTCDQVYN PAVSYASTDQ AVENTWYQRL TENGYIVPAF YRAGTKGDPG EQGSDVMSQW       300
     GSQYWATKGK TWDWILHYYY DPVDILPATE ADLRIYSGPN VTSTTPTWGE PFNVKVTVKN       360
     YGSEPMQLQE LYIKLRGPNG EILDLGGDDN SNPIDPGEVR TISKYVPRLA IDYPGLYGNY       420
     VLTVTYIDPG GFLAPGLPPG ESSTSTSIPL TVVAPSYKAQ IYSITPDSPS YYEQTTGSLT       480
     VKLRNTGNAT WYKNSSSIQN AVRLVTYNDA FHPSRFYVEG SWLSSSRILM QDSLVMPGGI       540
     GTFRFKLNGD LPPGNYTEYF RLRVEGSFGS TYRGFFGDQV AVNISVLDDS TPPSITINAP       600
     RYSTERSSEL SFPISWQGND EQTGVKDYDI YWKNGTDYVP WKSATSSTSA TFGNGDPINL       660
     AQGGNYLFRL RAEDIAGNVS SWRNFRVIVP FDDTRFSYNS GWRSYYNPYA RHYLHTYHYA       720
     YSYGRQATFS FYGRRVAWIG VKGPTRGMAE VWIDGSRIAT VDLYAPRYST RTVVFEKSLG       780
     TRNARHTITI KVLGKRNQLS TSNRVDIDGI AVLR                                   814
//

If you have problems or comments...

PBIL Back to PBIL home page