(data stored in ACNUC7421 zone)

EMBL: CP001825.PE44

CP001825.PE44        Location/Qualifiers
FT   CDS             complement(46948..47622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0045"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   sfu:Sfum_1786 peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40968"
FT                   /db_xref="GOA:D1CDG2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDG2"
FT                   /inference="protein motif:PFAM:PF00814"
FT                   /protein_id="ACZ40968.1"
FT                   /translation="MAKDLILALDTSDRRCGLAINRNGENLLDLSWDSGRSHTVQLMPW
FT                   LDYAFKQLRLSKESISAVAVTTGPGSFTAMRVGMATAKGICKALGVPIIGVPTLLYAAW
FT                   PYRYFCKHIVACLVLGRGRLAAALYASEDGGNLSLQWCRSLSLQELANELDSLPYDRVL
FT                   LCGDIPVELKENLKDSTRYLLLSPAESSRRLAVLAEIAWQRFRLGSVDNPATLQAEYLD
FT                   RK"
     MAKDLILALD TSDRRCGLAI NRNGENLLDL SWDSGRSHTV QLMPWLDYAF KQLRLSKESI        60
     SAVAVTTGPG SFTAMRVGMA TAKGICKALG VPIIGVPTLL YAAWPYRYFC KHIVACLVLG       120
     RGRLAAALYA SEDGGNLSLQ WCRSLSLQEL ANELDSLPYD RVLLCGDIPV ELKENLKDST       180
     RYLLLSPAES SRRLAVLAEI AWQRFRLGSV DNPATLQAEY LDRK                        224
//

If you have problems or comments...

PBIL Back to PBIL home page