(data stored in ACNUC7421 zone)

EMBL: CP001825.PE442

CP001825.PE442       Location/Qualifiers
FT   CDS             complement(491848..493638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0445"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: bsu:BSU01660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41366"
FT                   /db_xref="GOA:D1CEL0"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEL0"
FT                   /inference="protein motif:PFAM:PF01915"
FT                   /protein_id="ACZ41366.1"
FT                   /translation="MVPTIKRLLMAICILVLIGISACQDVVYRGSAITHASSSSWAEAT
FT                   LSKMTLREKIGQMFAVYVYGDSAYDTDPWAVNANRKLYGVDNASQIIQKYHVGSIIYFT
FT                   WTGNIKNAQQVARLSNGIQRSSMTQRVPVPTLISTDQEGGIISRLPSQIVRSPGNMALG
FT                   AARDKTYAFRAAYIVGKELRALGINQNLAPDADVNINPFNPVIGVRSFGDRSWLVARLT
FT                   AAQVRGYQSVDVAATAKHFPGHGDTNIDSHTGLPVIRHTQKQLEDIDLPPFRAAIDSGV
FT                   DVIMSAHIVVPSLDPSGRPATLSKPILTGLLRQKLGFKGVIMTDSLEMAGVRQMFPDSR
FT                   VPVEAIKAGADLLLMPPDLNLAINSVVNAVERGEISVSRINASVLRILELKARLGLPAN
FT                   PYVDADSVSSHVKTHWHILSAADISNHTITIIRNSGVLPLKPNSGRTVLVTGWGDEPTI
FT                   EVAAKMSSYGVRVTRYSTGDHPSSSVRDHAVYLARQKSLVVVLTRDIQWDTRQRELVKS
FT                   LIQTGKPVIVLSVELPYDLAYVTSAKTYVATYSYNPVSLRAAVRVMFGKASPVGKLPVR
FT                   IPKANAPQETLYPFGYGLGY"
     MVPTIKRLLM AICILVLIGI SACQDVVYRG SAITHASSSS WAEATLSKMT LREKIGQMFA        60
     VYVYGDSAYD TDPWAVNANR KLYGVDNASQ IIQKYHVGSI IYFTWTGNIK NAQQVARLSN       120
     GIQRSSMTQR VPVPTLISTD QEGGIISRLP SQIVRSPGNM ALGAARDKTY AFRAAYIVGK       180
     ELRALGINQN LAPDADVNIN PFNPVIGVRS FGDRSWLVAR LTAAQVRGYQ SVDVAATAKH       240
     FPGHGDTNID SHTGLPVIRH TQKQLEDIDL PPFRAAIDSG VDVIMSAHIV VPSLDPSGRP       300
     ATLSKPILTG LLRQKLGFKG VIMTDSLEMA GVRQMFPDSR VPVEAIKAGA DLLLMPPDLN       360
     LAINSVVNAV ERGEISVSRI NASVLRILEL KARLGLPANP YVDADSVSSH VKTHWHILSA       420
     ADISNHTITI IRNSGVLPLK PNSGRTVLVT GWGDEPTIEV AAKMSSYGVR VTRYSTGDHP       480
     SSSVRDHAVY LARQKSLVVV LTRDIQWDTR QRELVKSLIQ TGKPVIVLSV ELPYDLAYVT       540
     SAKTYVATYS YNPVSLRAAV RVMFGKASPV GKLPVRIPKA NAPQETLYPF GYGLGY           596
//

If you have problems or comments...

PBIL Back to PBIL home page