(data stored in ACNUC7421 zone)

EMBL: CP001825.PE443

CP001825.PE443       Location/Qualifiers
FT   CDS             493826..494920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0446"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: lch:Lcho_3206 oxidoreductase domain-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41367"
FT                   /db_xref="GOA:D1CEL1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEL1"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACZ41367.1"
FT                   /translation="MDQTIRVGVVGLGFAGNVHTMAYKKIPGVEVVALAGLEEDRLQLM
FT                   GKEYSIPNLYSRWEDLVARSDLDAVSVCTPNYLHAHVAIAALESGKHVLCEKPLARNTE
FT                   EAQSMVDAALRNRRVLQTAFNHRQRGDIMILKQYIDSGTLGKIYYAKGYWMRRQGIPGL
FT                   GSWFTSKELSGGGPLIDLGVHVLDQLMFLLGEPEITTVSASTYAEFGHRGRGVRRSGLQ
FT                   KMFVGADFDVEDLATAFMRTEDGTTVCLEASWAVQADYDDDFGLDLYGTEGGAQMRVKR
FT                   YGWQDTLRIFTDHGDVPVTIAPQTWQGTGHQAVVENFIDAIRSGNWSAHAGHEGLRRVQ
FT                   IVEACYKSALEGREISLQSIRQNV"
     MDQTIRVGVV GLGFAGNVHT MAYKKIPGVE VVALAGLEED RLQLMGKEYS IPNLYSRWED        60
     LVARSDLDAV SVCTPNYLHA HVAIAALESG KHVLCEKPLA RNTEEAQSMV DAALRNRRVL       120
     QTAFNHRQRG DIMILKQYID SGTLGKIYYA KGYWMRRQGI PGLGSWFTSK ELSGGGPLID       180
     LGVHVLDQLM FLLGEPEITT VSASTYAEFG HRGRGVRRSG LQKMFVGADF DVEDLATAFM       240
     RTEDGTTVCL EASWAVQADY DDDFGLDLYG TEGGAQMRVK RYGWQDTLRI FTDHGDVPVT       300
     IAPQTWQGTG HQAVVENFID AIRSGNWSAH AGHEGLRRVQ IVEACYKSAL EGREISLQSI       360
     RQNV                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page