(data stored in ACNUC7421 zone)

EMBL: CP001825.PE445

CP001825.PE445       Location/Qualifiers
FT   CDS             495543..496415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0448"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   azo:azo1719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41369"
FT                   /db_xref="GOA:D1CEL3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEL3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACZ41369.1"
FT                   /translation="MISVDVLIPTMNRLQSLIMTLSGVALQSRTDLGVIVADQSDEPAT
FT                   RSEVVRSLCKLIEARGNRVCWYHRKERCGIAEQRDFLLRVSSADAVLYLDDDVIMESWV
FT                   VEKMANVLEEQGCAFVGAFPTQPTYIDDVRPHQQHIEYWVSRVRPEIVNPGDPEWHRAT
FT                   LHTAANLFHVAQGLGLPPGDVRLYKVSWIGACVMYDRRKLLEIGGFSFWRRLPRKLVGE
FT                   DALVQNILMRLWGGCGIVPSGTYFAEVPSNFPDQYRSRDHHALMLLPEMIKTHAPHTPM
FT                   PKPDAWKYW"
     MISVDVLIPT MNRLQSLIMT LSGVALQSRT DLGVIVADQS DEPATRSEVV RSLCKLIEAR        60
     GNRVCWYHRK ERCGIAEQRD FLLRVSSADA VLYLDDDVIM ESWVVEKMAN VLEEQGCAFV       120
     GAFPTQPTYI DDVRPHQQHI EYWVSRVRPE IVNPGDPEWH RATLHTAANL FHVAQGLGLP       180
     PGDVRLYKVS WIGACVMYDR RKLLEIGGFS FWRRLPRKLV GEDALVQNIL MRLWGGCGIV       240
     PSGTYFAEVP SNFPDQYRSR DHHALMLLPE MIKTHAPHTP MPKPDAWKYW                  290
//

If you have problems or comments...

PBIL Back to PBIL home page