(data stored in ACNUC7421 zone)

EMBL: CP001825.PE450

CP001825.PE450       Location/Qualifiers
FT   CDS             complement(502660..504318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0453"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bha:BH2025 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41374"
FT                   /db_xref="GOA:D1CEL8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEL8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACZ41374.1"
FT                   /translation="MLKVSNISKSYDGHVVLQDISFVVSSGEHIGLLGANGSGKSTLLR
FT                   LIAGLEAPDTGSIWIDPNSRVAYLPQYPESDLELTVKESIDKALGGLYAVEEQISEIER
FT                   KLSYTDHASIEDLLDQYTKLREMFDLLGGYELEAKVDAVLKGLRFDGELDTPVSHLSGG
FT                   NKTKLSIAKVILSDANLLLLDEPTNYLDLSSLLWLEEFLSKSSKSYIVVSHDRRFLDKT
FT                   VESILELDKRTHSIRTWPGNYTAYNRLSTMEKAKALERYQDFKAETERIQQDIRRTKEQ
FT                   AKSTESKTNSDTARRLAKKVAAKAKARERRLERYLEENKVERPPREWSLDLRDLGKEAI
FT                   DDNRTILDIQGLTVEFDGKRVIDNLSLHLRGRDRVAILGPNGSGKSTLLKSILGLVPYK
FT                   GRITIGQGVRIGYISQDLLEVSGDERVIDIFRSRVSMHEVDARNYLHKFLFQGDEAIRP
FT                   ASHLSYGQRIKLALALITASAANFLVLDEPTSHIDMPAIESLEESLSSYTGPLLLVSHD
FT                   RYFLKEVGVNRLEVICNGKLITYSSLEEYEEVLHG"
     MLKVSNISKS YDGHVVLQDI SFVVSSGEHI GLLGANGSGK STLLRLIAGL EAPDTGSIWI        60
     DPNSRVAYLP QYPESDLELT VKESIDKALG GLYAVEEQIS EIERKLSYTD HASIEDLLDQ       120
     YTKLREMFDL LGGYELEAKV DAVLKGLRFD GELDTPVSHL SGGNKTKLSI AKVILSDANL       180
     LLLDEPTNYL DLSSLLWLEE FLSKSSKSYI VVSHDRRFLD KTVESILELD KRTHSIRTWP       240
     GNYTAYNRLS TMEKAKALER YQDFKAETER IQQDIRRTKE QAKSTESKTN SDTARRLAKK       300
     VAAKAKARER RLERYLEENK VERPPREWSL DLRDLGKEAI DDNRTILDIQ GLTVEFDGKR       360
     VIDNLSLHLR GRDRVAILGP NGSGKSTLLK SILGLVPYKG RITIGQGVRI GYISQDLLEV       420
     SGDERVIDIF RSRVSMHEVD ARNYLHKFLF QGDEAIRPAS HLSYGQRIKL ALALITASAA       480
     NFLVLDEPTS HIDMPAIESL EESLSSYTGP LLLVSHDRYF LKEVGVNRLE VICNGKLITY       540
     SSLEEYEEVL HG                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page