(data stored in ACNUC7421 zone)

EMBL: CP001825.PE452

CP001825.PE452       Location/Qualifiers
FT   CDS             complement(505548..506951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0455"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: bsu:BSU16160 ATP-dependent protease ATP-
FT                   binding subunit; TIGRFAM: heat shock protein HslVU, ATPase
FT                   subunit HslU; PFAM: ATPase AAA-2 domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41376"
FT                   /db_xref="GOA:D1CEM0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM0"
FT                   /inference="protein motif:TFAM:TIGR00390"
FT                   /protein_id="ACZ41376.1"
FT                   /translation="MQDFTPRQIVKELDKYIVGQDKAKRALAVALRNRYRRQQLPPEIR
FT                   DEVMPKNLMLIGPTGVGKTELARRLSKLVDAPFIKVEATKFTEVGYVGHDVESIVRELV
FT                   ETSVNMVHMKAMDRVKEEAEKAANERLINYLVRQSPKYKVLQEELESLADSEQESAAAS
FT                   TKKVVLERKMKRQRKRMAQMLAERRLDDEIVEIEVDPDPDLYSVVDIFADIGDSDESED
FT                   ATPLFSLDQSNRKRSRKVSVAEARRILVQEEAQKMIDFDAVIDEGVQKAEQDGIVFIDE
FT                   IDKLISNGYDSNADVSGEGVQRDLLPIVEGSNVVTRYGTVKTDHILFIAAGAFHDSKPS
FT                   DLIPELQGRFPLRVELEDLDAEDLKAILVEPDNSLIKQYQALLGTEGVELEFTPDGIDE
FT                   IARFAHEMNLKMENIGARRLQTVMERVLEDVAFDATDLEDKHVRIDRAYVKARLENLIE
FT                   NEDLSRFIL"
     MQDFTPRQIV KELDKYIVGQ DKAKRALAVA LRNRYRRQQL PPEIRDEVMP KNLMLIGPTG        60
     VGKTELARRL SKLVDAPFIK VEATKFTEVG YVGHDVESIV RELVETSVNM VHMKAMDRVK       120
     EEAEKAANER LINYLVRQSP KYKVLQEELE SLADSEQESA AASTKKVVLE RKMKRQRKRM       180
     AQMLAERRLD DEIVEIEVDP DPDLYSVVDI FADIGDSDES EDATPLFSLD QSNRKRSRKV       240
     SVAEARRILV QEEAQKMIDF DAVIDEGVQK AEQDGIVFID EIDKLISNGY DSNADVSGEG       300
     VQRDLLPIVE GSNVVTRYGT VKTDHILFIA AGAFHDSKPS DLIPELQGRF PLRVELEDLD       360
     AEDLKAILVE PDNSLIKQYQ ALLGTEGVEL EFTPDGIDEI ARFAHEMNLK MENIGARRLQ       420
     TVMERVLEDV AFDATDLEDK HVRIDRAYVK ARLENLIENE DLSRFIL                     467
//

If you have problems or comments...

PBIL Back to PBIL home page