(data stored in ACNUC7421 zone)

EMBL: CP001825.PE453

CP001825.PE453       Location/Qualifiers
FT   CDS             complement(507015..507572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0456"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   aba:Acid345_0214 ATP-dependent protease peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41377"
FT                   /db_xref="GOA:D1CEM1"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM1"
FT                   /inference="protein motif:PFAM:PF00227"
FT                   /protein_id="ACZ41377.1"
FT                   /translation="MSHNPPMMRATTILAVLRDGLLAMAGDGQVTFGDSIFKHKARKVR
FT                   TLYDGKVLVGFAGAVADALTLFERFESQLQQYSGDLRRSAVELAKQWRTDRYLRPLEAE
FT                   LIVGDPGQLLLITGQGEVIEPDEGILAIGSGSVYALAAAQALLRHTNMDAEHITLEAMK
FT                   IAAELCIYTNDNITIETIRAEN"
     MSHNPPMMRA TTILAVLRDG LLAMAGDGQV TFGDSIFKHK ARKVRTLYDG KVLVGFAGAV        60
     ADALTLFERF ESQLQQYSGD LRRSAVELAK QWRTDRYLRP LEAELIVGDP GQLLLITGQG       120
     EVIEPDEGIL AIGSGSVYAL AAAQALLRHT NMDAEHITLE AMKIAAELCI YTNDNITIET       180
     IRAEN                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page