(data stored in ACNUC7421 zone)

EMBL: CP001825.PE456

CP001825.PE456       Location/Qualifiers
FT   CDS             509705..510238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0459"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: sus:Acid_5737 ECF subfamily RNA
FT                   polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41380"
FT                   /db_xref="GOA:D1CEM4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM4"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACZ41380.1"
FT                   /translation="MALIDMAEAKEIQVDEFERIFLSYWEEIYLYLYRMLRDSQEAEDA
FT                   AQETFLKLYSRPPAANSNYRAWLYKVASREGLNRIRSNNRRTRLISKIKSLWSNEVAPD
FT                   TTDIVLANAESVEVRDILARMRPQYAQVLLLRHHGLSYDEISKVTGISKNSVGTILVRA
FT                   EKQFATLLERGEGK"
     MALIDMAEAK EIQVDEFERI FLSYWEEIYL YLYRMLRDSQ EAEDAAQETF LKLYSRPPAA        60
     NSNYRAWLYK VASREGLNRI RSNNRRTRLI SKIKSLWSNE VAPDTTDIVL ANAESVEVRD       120
     ILARMRPQYA QVLLLRHHGL SYDEISKVTG ISKNSVGTIL VRAEKQFATL LERGEGK          177
//

If you have problems or comments...

PBIL Back to PBIL home page