(data stored in ACNUC7421 zone)

EMBL: CP001825.PE457

CP001825.PE457       Location/Qualifiers
FT   CDS             510235..511350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41381"
FT                   /db_xref="GOA:D1CEM5"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41381.1"
FT                   /translation="MRCPSEGDLRSMLDNYRQELWEHVRSCKACSRRLESISQRKQLSA
FT                   GKLLANNSANCSAQQSYRSFVSRVERSKNMEFSEFGRRNPRPVLALVALLVLLPVLVLL
FT                   TPIRSAAESLLNVMRVEKFTAITIDPSQLPFNIPAEKYQQKWNQQMAARFGKYDKADLQ
FT                   KELKEHNIRRVSSVDEASKAYKGPVATIPKQGSPEEIYVSGPESASFTIDLQKIRAELK
FT                   EAGIQGVTLPKQLDGKTFTLDVPSAVVMRYGQDDSGFVFVQGESPTLVIPEGVNMDYVR
FT                   QDILMTPGLPPDLVKQIQSIKDWQHTLVIPVPPGGDSKNVRIGRSEGLLVSDRTGEHNL
FT                   LLWKHDDRLYAIGGKISSEDAISIARSVVYP"
     MRCPSEGDLR SMLDNYRQEL WEHVRSCKAC SRRLESISQR KQLSAGKLLA NNSANCSAQQ        60
     SYRSFVSRVE RSKNMEFSEF GRRNPRPVLA LVALLVLLPV LVLLTPIRSA AESLLNVMRV       120
     EKFTAITIDP SQLPFNIPAE KYQQKWNQQM AARFGKYDKA DLQKELKEHN IRRVSSVDEA       180
     SKAYKGPVAT IPKQGSPEEI YVSGPESASF TIDLQKIRAE LKEAGIQGVT LPKQLDGKTF       240
     TLDVPSAVVM RYGQDDSGFV FVQGESPTLV IPEGVNMDYV RQDILMTPGL PPDLVKQIQS       300
     IKDWQHTLVI PVPPGGDSKN VRIGRSEGLL VSDRTGEHNL LLWKHDDRLY AIGGKISSED       360
     AISIARSVVY P                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page