(data stored in ACNUC7421 zone)

EMBL: CP001825.PE459

CP001825.PE459       Location/Qualifiers
FT   CDS             512351..513193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0462"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_2141 ABC-type transport system,
FT                   putative ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41383"
FT                   /db_xref="GOA:D1CEM7"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACZ41383.1"
FT                   /translation="MRSLLIAKFTFKEALRKKLVIGVILLSIVFVALYVWGFSSLKNNF
FT                   DERIASGNPPPFSFEFFANALVLMGFYTVNFLCGVMAIFASVGSIASEIDNGTLHSIVP
FT                   KPIRRWEIVLGKWLGYAFMLAIYVLLMCAAVVITGKLIGDYVPPRYIYGSLLVVLVGIV
FT                   LLSITVLGSTLFSSLTNGIVVFMLYGVSLMGGIVKQVGEILDSSTLKNIGLATNLVIPS
FT                   DTLWRLASYVIQPRFSLQMGPTLLSSDTPPSNMMVVYAFAYITLALLIANWIFARRDL"
     MRSLLIAKFT FKEALRKKLV IGVILLSIVF VALYVWGFSS LKNNFDERIA SGNPPPFSFE        60
     FFANALVLMG FYTVNFLCGV MAIFASVGSI ASEIDNGTLH SIVPKPIRRW EIVLGKWLGY       120
     AFMLAIYVLL MCAAVVITGK LIGDYVPPRY IYGSLLVVLV GIVLLSITVL GSTLFSSLTN       180
     GIVVFMLYGV SLMGGIVKQV GEILDSSTLK NIGLATNLVI PSDTLWRLAS YVIQPRFSLQ       240
     MGPTLLSSDT PPSNMMVVYA FAYITLALLI ANWIFARRDL                             280
//

If you have problems or comments...

PBIL Back to PBIL home page