(data stored in ACNUC7421 zone)

EMBL: CP001825.PE460

CP001825.PE460       Location/Qualifiers
FT   CDS             complement(513264..513764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0463"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: gsu:GSU0538
FT                   HSP20 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41384"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM8"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACZ41384.1"
FT                   /translation="MLNRNFWDPFREMIRLSEAMDRLFEESFVRPTSWMLGRGGETGYW
FT                   VPIDIVETDNDYIVKASLPGFKPEDIQVNITGETLTISGNYKAEEPKDARYVLRERCLG
FT                   SFSRTITLPVPVEADKAVAHFEHGELTLTLPKVEEVRTKQIKISVGEQPQLSSTAESAQ
FT                   PQA"
     MLNRNFWDPF REMIRLSEAM DRLFEESFVR PTSWMLGRGG ETGYWVPIDI VETDNDYIVK        60
     ASLPGFKPED IQVNITGETL TISGNYKAEE PKDARYVLRE RCLGSFSRTI TLPVPVEADK       120
     AVAHFEHGEL TLTLPKVEEV RTKQIKISVG EQPQLSSTAE SAQPQA                      166
//

If you have problems or comments...

PBIL Back to PBIL home page