(data stored in ACNUC7421 zone)

EMBL: CP001825.PE461

CP001825.PE461       Location/Qualifiers
FT   CDS             514018..515643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0464"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="KEGG: sse:Ssed_0948 gamma-glutamyltransferase;
FT                   TIGRFAM: gamma-glutamyltransferase; PFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41385"
FT                   /db_xref="GOA:D1CEM9"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEM9"
FT                   /inference="protein motif:TFAM:TIGR00066"
FT                   /protein_id="ACZ41385.1"
FT                   /translation="MSDLQQRSPKAEVPISDLPFHSFERISMGLRGVVCTSNPLASDAA
FT                   MWALKDGGNAFDAALAAAAVLTVVEPQSSHLGGDVFLVAYVAKENKVYALNGSGRAPRE
FT                   IDISAFAGGIPERGPLAATIPGAVHGWCEVSRRWGKLPLKRVLQPAIEYARDGFPISVR
FT                   LARSISTLASIISMSPYARQQFLSIDPKPGNILRQPALARTLESIADRGVDGFYQGEIA
FT                   KEMVRGIREQCGVFSEDDLREHDTIVVVPISTSYRGVKVLEQPPVSQGHILLEELNIVE
FT                   NFDLKSMGLLSADTLHVLIEAKKLAFADKARYLGDPEFSKIPVEELVSKEWGRRRAEEI
FT                   NLSRANPQPEFGHLGRSNTDTTYLAVADSEGNAVSWIQSIFFVFGSGVVAGNTGVLLNN
FT                   RMNGFTIQPGHPNTLEPGKRPVHTLNAYILMKDDKPWIVGGTPGGDYQVQTNLQVISNL
FT                   VDFDLNIAEANDAPWWASLEGNNIRVENRVRQDILAELEKKGHKIDVIGAWAGDRIVQL
FT                   VQFGSNGALLGASDLRGEGYAAAW"
     MSDLQQRSPK AEVPISDLPF HSFERISMGL RGVVCTSNPL ASDAAMWALK DGGNAFDAAL        60
     AAAAVLTVVE PQSSHLGGDV FLVAYVAKEN KVYALNGSGR APREIDISAF AGGIPERGPL       120
     AATIPGAVHG WCEVSRRWGK LPLKRVLQPA IEYARDGFPI SVRLARSIST LASIISMSPY       180
     ARQQFLSIDP KPGNILRQPA LARTLESIAD RGVDGFYQGE IAKEMVRGIR EQCGVFSEDD       240
     LREHDTIVVV PISTSYRGVK VLEQPPVSQG HILLEELNIV ENFDLKSMGL LSADTLHVLI       300
     EAKKLAFADK ARYLGDPEFS KIPVEELVSK EWGRRRAEEI NLSRANPQPE FGHLGRSNTD       360
     TTYLAVADSE GNAVSWIQSI FFVFGSGVVA GNTGVLLNNR MNGFTIQPGH PNTLEPGKRP       420
     VHTLNAYILM KDDKPWIVGG TPGGDYQVQT NLQVISNLVD FDLNIAEAND APWWASLEGN       480
     NIRVENRVRQ DILAELEKKG HKIDVIGAWA GDRIVQLVQF GSNGALLGAS DLRGEGYAAA       540
     W                                                                       541
//

If you have problems or comments...

PBIL Back to PBIL home page