(data stored in ACNUC7421 zone)

EMBL: CP001825.PE462

CP001825.PE462       Location/Qualifiers
FT   CDS             515691..516788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0465"
FT                   /product="Mannose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /note="PFAM: mannose-6-phosphate isomerase type I; KEGG:
FT                   aba:Acid345_0569 mannose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41386"
FT                   /db_xref="GOA:D1CEN0"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014628"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEN0"
FT                   /inference="protein motif:PRIAM:5.3.1.8"
FT                   /protein_id="ACZ41386.1"
FT                   /translation="MPKLYPLIFEPELKEKIWGGRKLETILGKKLPPDVPIGESWEAYG
FT                   GNVVAYGDYRGMTVDQLVDELGSDLLGASIWESYDGIFPLLFKYIDANEFLSVQVHPDD
FT                   EYARTKAGYPKGKTESWYIVHAEPGAKLVHGWKKDTSPEEVEDAVRNNKLEELLEYIDV
FT                   QAGDVVFAPAGTVHAVGGGILLAEIQENSDITYRLYDWGRVGFDGKPRELHIKESLETL
FT                   DYHATAQHKNTPLSVAWDGVTRSYLVACRYFVAELMAGSVAFELDFQGDRFEILSLVSG
FT                   AVKLEWADNKISLRPGTTTLVPAALGRLRIVPESEDVRMLRMYVPRGLKEDVVEPLLSA
FT                   GYSLEQVLALGGDIRHNDIASVVQR"
     MPKLYPLIFE PELKEKIWGG RKLETILGKK LPPDVPIGES WEAYGGNVVA YGDYRGMTVD        60
     QLVDELGSDL LGASIWESYD GIFPLLFKYI DANEFLSVQV HPDDEYARTK AGYPKGKTES       120
     WYIVHAEPGA KLVHGWKKDT SPEEVEDAVR NNKLEELLEY IDVQAGDVVF APAGTVHAVG       180
     GGILLAEIQE NSDITYRLYD WGRVGFDGKP RELHIKESLE TLDYHATAQH KNTPLSVAWD       240
     GVTRSYLVAC RYFVAELMAG SVAFELDFQG DRFEILSLVS GAVKLEWADN KISLRPGTTT       300
     LVPAALGRLR IVPESEDVRM LRMYVPRGLK EDVVEPLLSA GYSLEQVLAL GGDIRHNDIA       360
     SVVQR                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page