(data stored in ACNUC7421 zone)

EMBL: CP001825.PE466

CP001825.PE466       Location/Qualifiers
FT   CDS             complement(518538..519035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0469"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: bam:Bamb_5585
FT                   MgtC/SapB transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41390"
FT                   /db_xref="GOA:D1CEN4"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEN4"
FT                   /inference="protein motif:PFAM:PF02308"
FT                   /protein_id="ACZ41390.1"
FT                   /translation="MEDFIPSIHDLIMSGQILLSLLLGGVIGFEREARNKPAGLRTHMM
FT                   VAAGTTAFTLASIYGFSMVSGQITRDPARVAAQIVSGIGFLGAGTIFRSGSSIRGLTTA
FT                   STIWLVASIGMLVGVGMYWLAIFTTVISTVVLSFMPAPIYKLERRLRVGEPSITPDDDD
FT                   EL"
     MEDFIPSIHD LIMSGQILLS LLLGGVIGFE REARNKPAGL RTHMMVAAGT TAFTLASIYG        60
     FSMVSGQITR DPARVAAQIV SGIGFLGAGT IFRSGSSIRG LTTASTIWLV ASIGMLVGVG       120
     MYWLAIFTTV ISTVVLSFMP APIYKLERRL RVGEPSITPD DDDEL                       165
//

If you have problems or comments...

PBIL Back to PBIL home page