(data stored in ACNUC7421 zone)

EMBL: CP001825.PE47

CP001825.PE47        Location/Qualifiers
FT   CDS             48547..49023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0048"
FT                   /product="ATP-cone domain protein"
FT                   /note="PFAM: ATP-cone domain protein; KEGG: sat:SYN_02369
FT                   transcriptional regulator NrdR"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40971"
FT                   /db_xref="GOA:D1CDG5"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDG5"
FT                   /inference="protein motif:PFAM:PF03477"
FT                   /protein_id="ACZ40971.1"
FT                   /translation="MRCPKCGSTRTRVTDSRETTNAIRRRRKCEDCGYRFTTYERIEQV
FT                   MPLVVKRDGTREEWDRNKLLTGIRLACNKRPVSYSTMQQIVDEIEEQFSGRQEVDSSEI
FT                   GQAVMKKLRVLDEVAYIRFASVYLRFHDVNGFIEAVEQVRRPQKPPEEQIPMNI"
     MRCPKCGSTR TRVTDSRETT NAIRRRRKCE DCGYRFTTYE RIEQVMPLVV KRDGTREEWD        60
     RNKLLTGIRL ACNKRPVSYS TMQQIVDEIE EQFSGRQEVD SSEIGQAVMK KLRVLDEVAY       120
     IRFASVYLRF HDVNGFIEAV EQVRRPQKPP EEQIPMNI                               158
//

If you have problems or comments...

PBIL Back to PBIL home page