(data stored in ACNUC7421 zone)

EMBL: CP001825.PE470

CP001825.PE470       Location/Qualifiers
FT   CDS             complement(523904..525373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0473"
FT                   /product="glutamate synthase, NADH/NADPH, small subunit"
FT                   /note="TIGRFAM: glutamate synthase, NADH/NADPH, small
FT                   subunit; PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: sus:Acid_3815 glutamate synthase
FT                   (NADH) small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41394"
FT                   /db_xref="GOA:D1CEN8"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEN8"
FT                   /inference="protein motif:TFAM:TIGR01317"
FT                   /protein_id="ACZ41394.1"
FT                   /translation="MVRNKLTAFIEIARHAPPRRPVEERVKDWKEVYVDLPEDVVQVQA
FT                   ARCMDCGVPFCHRGCPLGNLIPEWNDLVYRNHWKEAIERLHATNPFPEFTGKLCPAPCE
FT                   DSCVLSINSDPVTIKQVEWKIIDHAWREGWIKPNPPAIRTGKKVAIVGSGPAGLAAAQR
FT                   LNQAGHWVTVFERDDRIGGLIRYGIPEFKMDTSILNRRLNLLEQEGIVFKPNVNVGVDI
FT                   TADELLREFDAVILAIGATKPKDIRVPGRDLKGIHFAMEYLTMQNRRCEGDYIPDSEFI
FT                   SAEGKDVIIIGGGDTGADCLGTAHRQRAKSVTQFQLWAPPPKERAPNNPWPELPYVFTI
FT                   SAAHEEGGTREFCVSTKEFIGDENGHVRAIRAARIEVEYDEHGRRRAKEIPGSEFEMPA
FT                   DLVLLAMGYAGPETDGIVSQLGLELTERGNIATDAQKMTKIPGVFAAGDARIGQSLIVW
FT                   ALQEGRDVAKYVDLYLTENQRDSGQEKNYAA"
     MVRNKLTAFI EIARHAPPRR PVEERVKDWK EVYVDLPEDV VQVQAARCMD CGVPFCHRGC        60
     PLGNLIPEWN DLVYRNHWKE AIERLHATNP FPEFTGKLCP APCEDSCVLS INSDPVTIKQ       120
     VEWKIIDHAW REGWIKPNPP AIRTGKKVAI VGSGPAGLAA AQRLNQAGHW VTVFERDDRI       180
     GGLIRYGIPE FKMDTSILNR RLNLLEQEGI VFKPNVNVGV DITADELLRE FDAVILAIGA       240
     TKPKDIRVPG RDLKGIHFAM EYLTMQNRRC EGDYIPDSEF ISAEGKDVII IGGGDTGADC       300
     LGTAHRQRAK SVTQFQLWAP PPKERAPNNP WPELPYVFTI SAAHEEGGTR EFCVSTKEFI       360
     GDENGHVRAI RAARIEVEYD EHGRRRAKEI PGSEFEMPAD LVLLAMGYAG PETDGIVSQL       420
     GLELTERGNI ATDAQKMTKI PGVFAAGDAR IGQSLIVWAL QEGRDVAKYV DLYLTENQRD       480
     SGQEKNYAA                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page