(data stored in ACNUC7421 zone)

EMBL: CP001825.PE472

CP001825.PE472       Location/Qualifiers
FT   CDS             complement(530525..531268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0475"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: tcx:Tcr_0985
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41396"
FT                   /db_xref="GOA:D1CEP0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D1CEP0"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACZ41396.1"
FT                   /translation="MRRFWLEVRYLFTIQILEERGWLAGTIFFTTVFPLLLVFGLGLIG
FT                   SGQTKEGLTYIITGSTISSLTFVGITMVGQSLGWMKDRGDFLYYASLPISKSSLIVAVM
FT                   ASKLVLQLPGIIAALVGGTLMYDLHFKPNPVVIIILPLTALALSGLGAAIGLLSPSYQL
FT                   VNIFSQVAGITVMFAAPVMIPWESLPRVLQWFGWLLPPSYAADALRRAVLGINDTRLMM
FT                   DLLVLTTCALVSIIGVTRGLRWRLR"
     MRRFWLEVRY LFTIQILEER GWLAGTIFFT TVFPLLLVFG LGLIGSGQTK EGLTYIITGS        60
     TISSLTFVGI TMVGQSLGWM KDRGDFLYYA SLPISKSSLI VAVMASKLVL QLPGIIAALV       120
     GGTLMYDLHF KPNPVVIIIL PLTALALSGL GAAIGLLSPS YQLVNIFSQV AGITVMFAAP       180
     VMIPWESLPR VLQWFGWLLP PSYAADALRR AVLGINDTRL MMDLLVLTTC ALVSIIGVTR       240
     GLRWRLR                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page